PDA

View Full Version : Clubdom.com videos



Pages : 1 2 3 4 5 6 7 8 [9] 10 11 12 13

Tiered
12-21-2021, 06:39 AM
Clubdom.com- Slutty Balls Get Trampled
https://img202.imagetwist.com/th/44590/50mo7rewtgbg.jpg (https://imagetwist.com/50mo7rewtgbg/cd_s338_ball_trampling_jerk_off.jpg)
https://img202.imagetwist.com/th/44590/1lgs7e3vay24.jpg (https://imagetwist.com/1lgs7e3vay24/cd_s338_ball_trampling_jerk_off.mp4.jpg)

Description:
Ms. Venus Divine has her slave_s balls on a rope. She flashes her spiky shoes and taunts this bitch. His balls are so full Before she demands that he empty them she is going to stand on them. There is no more painful time to crush a man_s balls than when the are full of male filth Venus flattens this slut_s balls. Then she demands that he jerk off at her feet. When the slut cums on the floor, Venus shoves his head down and makes him lick up every drop
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : cd_s338_ball_trampling_jerk_off.mp4
File Size : 295.15 MB
Resolution : 1280x720
Duration : 00:06:10

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a2ae3c018f4c5 (https://tezfiles.com/file/a2ae3c018f4c5)

Tiered
12-21-2021, 06:55 AM
Clubdom.com- Slapped Down
https://img119.imagetwist.com/th/44586/oqp55n1tq0br.jpg (https://imagetwist.com/oqp55n1tq0br/slappeddown.jpg)
https://img202.imagetwist.com/th/44586/e1uvyaget74m.jpg (https://imagetwist.com/e1uvyaget74m/slappeddown.mp4.jpg)

Description:
Goddess Brianna and Mistress Carmen are tired of their back talking bitch_s mouth. The ladies grab the slut and slap him in the repeatedly. The slut_s face grows fire engine red as the ladies keep the smacks coming.
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : slappeddown.mp4
File Size : 56.32 MB
Resolution : 640x360
Duration : 00:07:00

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/bc7db687d5a37 (https://tezfiles.com/file/bc7db687d5a37)

Tiered
12-21-2021, 07:00 AM
Clubdom.com- Trampled Under Our Boots
https://img119.imagetwist.com/th/44642/101g7phvw5kx.jpg (https://imagetwist.com/101g7phvw5kx/cd_scene_09_30_12_trampling.jpg)
https://img33.imagetwist.com/th/44642/1gepa8zwanbz.jpg (https://imagetwist.com/1gepa8zwanbz/cd_scene_09_30_12_trampling.mp4.jpg)

Description:
Mistresses Jade Tiger and Lara Luxe amuse themselves by using their boots and bot heels to trample and abuse their slave bitch. The Mistresses take turns jumping up and down on his prone body, making him take the full pain of their boots and heels onto his stomach, face, and cock and balls as they enjoy themselves art his expense. He is nothing but a human exercise mat to them, so pathetic for their beauty that he is even grateful that they bother to slap and spit in his face as they toy with him. This slave will learn that he is lower than the ground his beautiful Mistresses walk on.
Model:
Jade Tiger, Lara Luxe
Studio:
Clubdom.com
Info:
File Name : cd_scene_09_30_12_trampling.mp4
File Size : 52.62 MB
Resolution : 640x360
Duration : 00:06:35

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/fb6ae6c71a3d0 (https://tezfiles.com/file/fb6ae6c71a3d0)

Tiered
12-21-2021, 08:09 AM
Clubdom.com- Slave Fucks Mistress Part 2
https://img202.imagetwist.com/th/44590/1ounxavoifhe.jpg (https://imagetwist.com/1ounxavoifhe/cd_s300_minimovie_part2.jpg)
https://img119.imagetwist.com/th/44590/uhpygkpjdtlz.jpg (https://imagetwist.com/uhpygkpjdtlz/cd_s300_minimovie_part2.mp4.jpg)

Description:
Slave Fucks Mistress Part 2
Model:
Mistress Yuri
Studio:
Clubdom.com
Info:
File Name : cd_s300_minimovie_part2.mp4
File Size : 264.06 MB
Resolution : 1280x720
Duration : 00:05:35

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a504447b77f9f (https://tezfiles.com/file/a504447b77f9f)

Tiered
12-21-2021, 08:16 AM
Clubdom.com- Break the Bitch In
https://img202.imagetwist.com/th/44577/mjl9pwi29hoh.jpg (https://imagetwist.com/mjl9pwi29hoh/breakthebitch213.jpg)
https://img202.imagetwist.com/th/44577/0edcanmfb2fp.jpg (https://imagetwist.com/0edcanmfb2fp/breakthebitch213.mp4.jpg)

Description:
Goddess Giselle has a new toy to play with she. She locks the slut in caning stock and lets loose on this helpless ass. Instant red welts rise up on the slut_s trembling ass. Turned on by the slave_s suffer, Giselle beats the bittch even harder. She enjoys breaking in this new bitch.
Model:
Giselle
Studio:
Clubdom.com
Info:
File Name : breakthebitch213.mp4
File Size : 255.59 MB
Resolution : 1280x720
Duration : 00:05:21

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1ebf43b353e62 (https://tezfiles.com/file/1ebf43b353e62)

Tiered
12-21-2021, 08:28 AM
Clubdom.com- Nasty Nuts
https://img119.imagetwist.com/th/44549/u9yy3908kqad.jpg (https://imagetwist.com/u9yy3908kqad/cd_s06_meagan_cbt.jpg)
https://img119.imagetwist.com/th/44549/13c3ehpl1cun.jpg (https://imagetwist.com/13c3ehpl1cun/cd_s06_meagan_cbt.mp4.jpg)

Description:
Mistress Megan is so disgusted with her worthless slut_s balls that she set outs to destroy them. She crops and smacks the bitch_s nuts until they are turn purple. Then she twists the bitch_s cock like it is a pretzle. There will be no recovery for this slut_s pathetic manhood.
Model:
Megan Jones
Studio:
Clubdom.com
Info:
File Name : cd_s06_meagan_cbt.mp4
File Size : 337.68 MB
Resolution : 1280x720
Duration : 00:07:03

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/5e47987611a23 (https://tezfiles.com/file/5e47987611a23)

Tiered
12-21-2021, 08:29 AM
Clubdom.com- Choking on His Nuts
https://img33.imagetwist.com/th/44564/g379om6ldlrr.jpg (https://imagetwist.com/g379om6ldlrr/cd_s175_megan_ballbusting.jpg)
https://img119.imagetwist.com/th/44564/u5an5ekpp7yc.jpg (https://imagetwist.com/u5an5ekpp7yc/cd_s175_megan_ballbusting.mp4.jpg)

Description:
Mistress Megan shows her sister, Kristen, how to bust a man_s nuts. Megan delivers blow after blow to the bound slut_s ball as Kristen watches eagerly. Then Megan offers the bitch_s nuts to Kristen and BAM She nails his aching balls on. By the time the ladies are finished the slut is crumbled in a fetal position on the floor.
Model:
Megan Jones
Studio:
Clubdom.com
Info:
File Name : cd_s175_megan_ballbusting.mp4
File Size : 281.6 MB
Resolution : 1280x720
Duration : 00:05:54

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4683a54f0ff2d (https://tezfiles.com/file/4683a54f0ff2d)

Tiered
12-21-2021, 08:29 AM
Clubdom.com- Leena Wants to Cum
https://img165.imagetwist.com/th/44645/13l267h1lr4h.jpg (https://imagetwist.com/13l267h1lr4h/cd_scene_11_05_12_minimoviepart2.jpg)
https://img165.imagetwist.com/th/44645/w2i4g2a4uu8p.jpg (https://imagetwist.com/w2i4g2a4uu8p/cd_scene_11_05_12_minimoviepart2.mp4.jpg)

Description:
Mistress Leena is furious with her slave for cumming before she wanted and wants even more pleasure. If the slave_s cock won_t provide it, then his face will - with the help of a dildo strapped to it

Leena rides the chin dildo to an orgasm, shocking the bound bitch_s balls with an electric shock collar whenever he does not fuck her hard enough. This slave is nothing but a toy for Leena to use for her sexual pleasure.
Model:
Leena Sky
Studio:
Clubdom.com
Info:
File Name : cd_scene_11_05_12_minimoviepart2.mp4
File Size : 50.85 MB
Resolution : 640x360
Duration : 00:06:23

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d5c921f3009e5 (https://tezfiles.com/file/d5c921f3009e5)

Tiered
12-21-2021, 08:56 AM
Clubdom.com- Bound Cock and Ball Beating
https://img202.imagetwist.com/th/44592/xyxi9eargbns.jpg (https://imagetwist.com/xyxi9eargbns/07_11_12_cbt.jpg)
https://img202.imagetwist.com/th/44592/wgw3jp57oa4u.jpg (https://imagetwist.com/wgw3jp57oa4u/07_11_12_cbt.mp4.jpg)

Description:
Goddess Cheyenne has her slave bound in the stocks, with his cock roped off and helpless, exposing his balls for her abuse. Her slave is desperate to worship her boots and feet, but such rewards have to be earned - by suffering.

Cheyenne crops his cock and balls until they are bruised, then adds several rubber tipped clothespins to his balls all the better to pinch and hurt his nutsack. She toys with his balls, crushing them in her hand,which causes the clothespins to dig in even more, before using her crop again to really turn up the suffering.

When it is time for the clothespins to come off, Cheyenne skillfully knocks them all off with one stroke from her whip, putting the slave into agony. She holds his destroyed balls in her hand to inspect them, the slightest pressure causing severe pain. Will his suffering be enough to earn a reward?
Model:
Cheyenne Jewel
Studio:
Clubdom.com
Info:
File Name : 07_11_12_cbt.mp4
File Size : 52.68 MB
Resolution : 640x360
Duration : 00:06:32

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f09c094d95986 (https://tezfiles.com/file/f09c094d95986)

Tiered
12-21-2021, 09:02 AM
Clubdom.com- Caning for Training
https://img165.imagetwist.com/th/44587/vb3wpvktg7ca.jpg (https://imagetwist.com/vb3wpvktg7ca/102310c.jpg)
https://img165.imagetwist.com/th/44587/61bpfhw4ghia.jpg (https://imagetwist.com/61bpfhw4ghia/102310c.mp4.jpg)

Description:
Goddess Brianna is surprisingly sadistic. She drags one of her subjects from the fields to the caning bench. She doesn_t care that the poor slave has just been savagely beaten the day before. Brianna is enjoying teaching Mistress Alana the finer points of disciplining men. Brianna lays in hard and heavy with her cane. Blistering the slut_s aching ass with fast and furious strokes. Alana is eager to try her hand. She is a natural Brianna smiles proudly as Alana steps up with brute force strokes. The ladies know how to enjoy their male bitches.
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : 102310c.mp4
File Size : 59.16 MB
Resolution : 640x360
Duration : 00:06:52

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e4caf73195dba (https://tezfiles.com/file/e4caf73195dba)

Tiered
12-21-2021, 09:17 AM
Clubdom.com- Sixty Nine the Slave
https://img33.imagetwist.com/th/44563/qrhmislbo4lk.jpg (https://imagetwist.com/qrhmislbo4lk/cd_s69_coral_alexis_stapon_buttfuck.jpg)
https://img33.imagetwist.com/th/44563/5o41x2z6i69l.jpg (https://imagetwist.com/5o41x2z6i69l/cd_s69_coral_alexis_stapon_buttfuck.mp4.jpg)

Description:
Mistress coral and Goddess alexis have just finished caning a slave. The beating have gotten the ladies hot and horny. Now they want a little action. coral bends the bitch over and starts pumping his ass full of her strap on cock. As she rides the bitch_s ass alexis grabs the slut by the back of his head and forces him to please her with a dildo strapped to his chin. alexis fucks the slut_s face. coral fucks his ass. alexis puts her hand on the slut_s head and holds him down. He won_t be finished until there is cum dripping down her legs. This bitch is in for a long night.
Model:
Alexis Fawx, Coral
Studio:
Clubdom.com
Info:
File Name : cd_s69_coral_alexis_stapon_buttfuck.mp4
File Size : 300.96 MB
Resolution : 1280x720
Duration : 00:06:21

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/abd83a1bbb742 (https://tezfiles.com/file/abd83a1bbb742)

Tiered
12-21-2021, 10:20 AM
Clubdom.com- Cum and The Balls Get It
https://img202.imagetwist.com/th/44586/1gsnk7b6h83s.jpg (https://imagetwist.com/1gsnk7b6h83s/cumandtheballsgetit.jpg)
https://img119.imagetwist.com/th/44586/i23xix6w7pwi.jpg (https://imagetwist.com/i23xix6w7pwi/cumandtheballsgetit.mp4.jpg)

Description:
Goddess Brianna and Mistress Stevie enjoy little more than ruining a male bitch_s orgasm. They have a slut restrained to a bondage chair as the rules of their sinister game is explained. If the bitch cum_s he gets punched in the balls HARD. If he can refrain from cumming, he won_t. Brianna and Stevie bring stroke this slut_s cock right to orgasm. The male bitch is terrified as his body betrays him. BAM The bitch gets nailed in the nuts with full force twice
Model:
Goddess Brianna, Stevie Shae
Studio:
Clubdom.com
Info:
File Name : cumandtheballsgetit.mp4
File Size : 46.22 MB
Resolution : 640x360
Duration : 00:05:50

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/750324c11bc2d (https://tezfiles.com/file/750324c11bc2d)

Tiered
12-21-2021, 10:23 AM
Clubdom.com- Spit Face Bitch
https://img119.imagetwist.com/th/44553/p3glhp5ahtl7.jpg (https://imagetwist.com/p3glhp5ahtl7/cd_s26_alexis_spitfacebitchcorrect.jpg)
https://img202.imagetwist.com/th/44553/r8z933i1wlz6.jpg (https://imagetwist.com/r8z933i1wlz6/cd_s26_alexis_spitfacebitchcorrect.mp4.jpg)

Description:
Alexis Reigns has just won a round on the mat and is all fired up. When the towel boy comes out to clean up, Alexis can_t help but harass him. She spits on the mat and demands that he lick it up. Then she throws him down and starts spitting on his face. Alexis laughs as she drenches the bitch with spit. Then she drags him around by his hair, mopping her spit off the mat with his face.
Model:
Allison
Studio:
Clubdom.com
Info:
File Name : cd_s26_alexis_spitfacebitchcorrect.mp4
File Size : 281.73 MB
Resolution : 1280x720
Duration : 00:05:53

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4676d28732b41 (https://tezfiles.com/file/4676d28732b41)

Tiered
12-21-2021, 11:07 AM
Clubdom.com- Caning the slut
https://img165.imagetwist.com/th/44587/ybdk2chbcpgl.jpg (https://imagetwist.com/ybdk2chbcpgl/031210d.jpg)
https://img165.imagetwist.com/th/44587/dtxxj4htv6v4.jpg (https://imagetwist.com/dtxxj4htv6v4/031210d.wmv.jpg)

Description:
Casey drags her slut out and straps him down. She is going to cane this bitch until he cries. Then she is going to cane him even more. Casey means business with her bamboo cane.
Model:
Casey
Studio:
Clubdom.com
Info:
File Name : 031210d.wmv
File Size : 318.52 MB
Resolution : 1280x720
Duration : 00:07:09

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1fc7fb3cde1b9 (https://tezfiles.com/file/1fc7fb3cde1b9)

Tiered
12-21-2021, 11:30 AM
Clubdom.com- Pull the Cum Out
https://img202.imagetwist.com/th/44565/rr5vkgckctn6.jpg (https://imagetwist.com/rr5vkgckctn6/cd_s184_hand_job.jpg)
https://img119.imagetwist.com/th/44565/cs8ol67ubj0q.jpg (https://imagetwist.com/cs8ol67ubj0q/cd_s184_hand_job.mp4.jpg)

Description:
Ashley Edmund knows how to control her slaves. Once a month they are milked and once a month, Ashly ruins their orgasm. Ashley loves the way the slut_s balls are emptied but their mind stays horny.
Model:
Ashley Edmonds
Studio:
Clubdom.com
Info:
File Name : cd_s184_hand_job.mp4
File Size : 332.99 MB
Resolution : 1280x720
Duration : 00:06:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/477ebb075f266 (https://tezfiles.com/file/477ebb075f266)

Tiered
12-21-2021, 11:39 AM
Clubdom.com- Caned and Prodded
https://img202.imagetwist.com/th/44590/bguyf9hjlkpq.jpg (https://imagetwist.com/bguyf9hjlkpq/339_cainingcaddleprod.jpg)
https://img119.imagetwist.com/th/44591/zplcjp2qpdmm.jpg (https://imagetwist.com/zplcjp2qpdmm/339_cainingcaddleprod.mp4.jpg)

Description:
Ms. Venus Divine and Eden Adams pull a slave out of his cage. His balls are locked behind him in a humbler. Eden shoves his head to the ground and Venus begins a vicious caning. Eden begins shocking the slut with a cattle prod. The ladies get off on being cruel to this bitch. Eden keeps the electric jolts coming as Venus stripes the slut_s ass. When the ladies have had their fill they put the slut back in his cage to sleep outside in the storm.
Model:
Caning, CBT
Studio:
Clubdom.com
Info:
File Name : 339_cainingcaddleprod.mp4
File Size : 305.45 MB
Resolution : 1280x720
Duration : 00:06:28

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/79445f4dd0316 (https://tezfiles.com/file/79445f4dd0316)

Tiered
12-21-2021, 11:49 AM
Clubdom.com- Fucked to Tears
https://img202.imagetwist.com/th/44587/1m1ifgtwig1q.jpg (https://imagetwist.com/1m1ifgtwig1q/010412strapon.jpg)
https://img119.imagetwist.com/th/44587/0b4f1f1zae6o.jpg (https://imagetwist.com/0b4f1f1zae6o/010412strapon.mp4.jpg)

Description:
Once upon a time, this bitch was a stud - getting to fuck Mistress Stevie right in front of her cuckolded ex boyfriend. But Stevie has grown tired of her new fucktoy, as all Mistresses eventually do, and has decided to make him yet another broken cuckold at her boots.

Stevie starts off by making him gag on her huge strapon, vowing to make him cry. And cry the bitch does as Stevie pounds his ass so hard his entire body starts convulsing - only making her burst out in laughter and fuck the bitch even harder.

Stevie pulls her cock out of her broken slave and gloats at the site of the tears running down his face. I told you I was going to fuck you to tears. I own you now, bitch.
Model:
Stevie Shae
Studio:
Clubdom.com
Info:
File Name : 010412strapon.mp4
File Size : 53.31 MB
Resolution : 640x360
Duration : 00:06:40

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/7839e71cb5dde (https://tezfiles.com/file/7839e71cb5dde)

Tiered
12-21-2021, 01:09 PM
Clubdom.com- Shae Fatale and Alexis Grace POV
https://img202.imagetwist.com/th/44589/3ltq1l1f0n2s.jpg (https://imagetwist.com/3ltq1l1f0n2s/cd_s279_pov.jpg)
https://img119.imagetwist.com/th/44589/xf9qfdeeindh.jpg (https://imagetwist.com/xf9qfdeeindh/cd_s279_pov.mp4.jpg)

Description:
Shae Fatale and Alexis Grace POV Masturbation
Model:
Alexis Grace, Shae Fatale
Studio:
Clubdom.com
Info:
File Name : cd_s279_pov.mp4
File Size : 305.86 MB
Resolution : 1280x720
Duration : 00:06:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/397c04b932582 (https://tezfiles.com/file/397c04b932582)

Tiered
12-21-2021, 01:41 PM
Clubdom.com- Shoot And Get Ball Punched
https://img119.imagetwist.com/th/44637/zeepp1vic0dt.jpg (https://imagetwist.com/zeepp1vic0dt/cd_s388_brianna_foot_job_ball_punch.jpg)
https://img202.imagetwist.com/th/44637/bs0rm2yt6xpw.jpg (https://imagetwist.com/bs0rm2yt6xpw/cd_s388_brianna_foot_job_ball_punch.mp4.jpg)

Description:
Goddess Brianna wants to play a game with her bound slave. If he can receive a foot job from her without cumming, then nothing will happen. But if he shoots his load, she is going to punch him right in the balls again and again

Brianna lets the bitch worship her beautiful feet for a while, knowing that the slave is a foot slut and it will make him horny. Brianna then goes to work on his cock with her feet, soft and oiled up to make them even softer. The slave tries to resist but is no match for Brianna_s excellent milking skills, shooting his load all over her feet. True to her word, Brianna clamps down on his balls with one hand as she punches with the other. Brianna laughs at his suffering she has won her game yet again.
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : cd_s388_brianna_foot_job_ball_punch.mp4
File Size : 231.34 MB
Resolution : 1280x720
Duration : 00:04:53

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/aa4defbea1ebb (https://tezfiles.com/file/aa4defbea1ebb)

Tiered
12-21-2021, 01:42 PM
Clubdom.com- Cattle Prod Sadism
https://img119.imagetwist.com/th/44585/n53o46td3o4e.jpg (https://imagetwist.com/n53o46td3o4e/cattleprodsadism.jpg)
https://img119.imagetwist.com/th/44585/qm1x2f9e12h5.jpg (https://imagetwist.com/qm1x2f9e12h5/cattleprodsadism.mp4.jpg)

Description:
Having already bullwhipped this sexist bitch, Mistress Simone Kross makes sure that he learns the lesson that men like him are nothing but play toys to women like her. Arms chained overhead, the bitch is helpless to escape as Simone stalks him with her cattle prod. As she shocks him again and again, she just laughs at his futile attempts to escape from the pain.
Simone decides to further emasculate the bitch by fucking him up the ass, but not before making him beg for it while she continues to shock his ass. Now wearing her strapon, Simone binds her new slave to her cage and coldly continues the cattle prod torture. Never will a bitch be so grateful to have his ass fucked.
Model:
Simone Kross
Studio:
Clubdom.com
Info:
File Name : cattleprodsadism.mp4
File Size : 37.54 MB
Resolution : 640x360
Duration : 00:04:38

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f0ef5f7b935a1 (https://tezfiles.com/file/f0ef5f7b935a1)

Tiered
12-21-2021, 02:04 PM
Clubdom.com- Work Both These Cocks
https://img202.imagetwist.com/th/44593/bv59lf5sgglt.jpg (https://imagetwist.com/bv59lf5sgglt/07_12_12_straponp2.jpg)
https://img119.imagetwist.com/th/44593/b6tz5mg0qpr4.jpg (https://imagetwist.com/b6tz5mg0qpr4/07_12_12_straponp2.mp4.jpg)

Description:
After Mistress Kendra has popped this strapon newbie_s cherry, Goddess Cheyenne takes over the ass fucking fun while Kendra breaks the bitch in to a new activity - ass to mouth cleaning her strapon cock. Cheyenne makes sure to fuck the bitch slow and hard, crushing his bound balls with her strapon just for the fun of it. All the while, Kendra is making sure that he is properly cleaning his ass juices off of her cock while he is being fucked. Every slut must properly learn how to work two cocks at once.

Once the bitch_s ass has been thoroughly fucked, Cheyenne wants her cock cleaned as well. The Mistresses enjoy watching the slave trying to clean both of their cocks at the same time, laughing at his efforts. They have broken in a new cock craving slut.
Model:
Cheyenne Jewel, Kendra James
Studio:
Clubdom.com
Info:
File Name : 07_12_12_straponp2.mp4
File Size : 49.94 MB
Resolution : 640x360
Duration : 00:06:12

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/82a769f19a99e (https://tezfiles.com/file/82a769f19a99e)

Tiered
12-21-2021, 02:32 PM
Clubdom.com- Ball Busting by Brianna
https://img165.imagetwist.com/th/44637/qk6cq7ws06ui.jpg (https://imagetwist.com/qk6cq7ws06ui/385_ballbusting.jpg)
https://img202.imagetwist.com/th/44637/cwon3pyroyp9.jpg (https://imagetwist.com/cwon3pyroyp9/385_ballbusting.mp4.jpg)

Description:
Ball Busting by Brianna
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : 385_ballbusting.mp4
File Size : 280.45 MB
Resolution : 1280x720
Duration : 00:05:56

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/83e09fcdc1924 (https://tezfiles.com/file/83e09fcdc1924)

Tiered
12-21-2021, 02:54 PM
Clubdom.com- Women Fuck Men
https://img119.imagetwist.com/th/44553/7wphc334zos6.jpg (https://imagetwist.com/7wphc334zos6/cd_s96_brianna_womenfuckmen.jpg)
https://img33.imagetwist.com/th/44553/es5fx8s6vcyw.jpg (https://imagetwist.com/es5fx8s6vcyw/cd_s96_brianna_womenfuckmen.mp4.jpg)

Description:
Goddess Brianna has her bitch_s head locked into a standing vice and his balls in a humbler. She brandishes her big black cock and laughs. She is going to take this bitch_s manhood inch by inch. Brianna rides the slut_s ass as she punishes his balls. Brianna is glowing with joy as she emasculates this bitch.
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : cd_s96_brianna_womenfuckmen.mp4
File Size : 310.81 MB
Resolution : 1280x720
Duration : 00:06:33

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/5a71d50b4763a (https://tezfiles.com/file/5a71d50b4763a)

Tiered
12-21-2021, 03:06 PM
Clubdom.com- Fucked with is own Cum 1
https://img33.imagetwist.com/th/44553/b7hfhwxf4h27.jpg (https://imagetwist.com/b7hfhwxf4h27/cd_s76_hailey_fuckedwithhisowncum1.jpg)
https://img33.imagetwist.com/th/44553/wjxgus72xfsy.jpg (https://imagetwist.com/wjxgus72xfsy/cd_s76_hailey_fuckedwithhisowncum1.mp4.jpg)

Description:
Goddess Hailey is in the mood for a little ass. She puts her slut on his knees and shows him the 12 inch cock that she will be fucking him with. First, she makes him empty his balls. She demands that he jerk off all over the cock. Afterall, he will need lube. After the trembling slut spills his filth on the cock Hailey smears some of this cum on his face. The slut_s cum is still dripping down his face as Hailey pile drives his ass with her huge cock. How does it feel to get fucked with your own cum? She asks as she rides the bitch hard.
Model:
Hailey Young
Studio:
Clubdom.com
Info:
File Name : cd_s76_hailey_fuckedwithhisowncum1.mp4
File Size : 363.1 MB
Resolution : 1280x720
Duration : 00:07:38

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4bca104dbfbf2 (https://tezfiles.com/file/4bca104dbfbf2)

Tiered
12-21-2021, 03:34 PM
Clubdom.com- Chastity Ride
https://img33.imagetwist.com/th/44558/8dbtilit9b1k.jpg (https://imagetwist.com/8dbtilit9b1k/cd_s140_chastity_tease.jpg)
https://img69.imagetwist.com/th/44559/r0zx0exkbgsg.jpg (https://imagetwist.com/r0zx0exkbgsg/cd_s140_chastity_tease.mp4.jpg)

Description:
Christy Mack enjoys tormenting her chastised boyfriend. She has him tied to a bed, spread eagle and dangles his chastity key. When she tells him that she is horny and is going to use his body to get off, his spirits lift....but not for long. Christy proceeds to rub her clit against the chastity device until her pussy is wet. She wonders if he can feel her pussy juices dripping through the chastity device onto his locked up cock. Then Christy straddles his locked up cock and goes for a ride. She laughs as she cums. Too bad her boyfriend can_t feel a thing through that device. Penelope runs her pussy juices under his nose so he can tell that she came.
Model:
Christy Mack
Studio:
Clubdom.com
Info:
File Name : cd_s140_chastity_tease.mp4
File Size : 271 MB
Resolution : 1280x720
Duration : 00:05:40

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ee32fa357a1a3 (https://tezfiles.com/file/ee32fa357a1a3)

Tiered
01-17-2022, 11:57 AM
Clubdom.com- Two Male Bitches Get Ass Fucked
https://img202.imagetwist.com/th/44720/58ilkto8ahh5.jpg (https://imagetwist.com/58ilkto8ahh5/twomalebitchesgetassfucked.jpg)
https://img119.imagetwist.com/th/44720/j2qlykjeifer.jpg (https://imagetwist.com/j2qlykjeifer/twomalebitchesgetassfucked.mp4.jpg)

Description:
Sasha Meow and Goddess Esmi line up two male bitches and devour them with their strap on dicks. They make the _ suck their cocks and then bend them over and take their man pussies with deep and forceful thrusts. Esmi_s smiles as she feeds 10 inches of love into her slut_s tight little ass.
Model:
Esmi Lee, Sasha Meow
Studio:
Clubdom.com
Info:
File Name : twomalebitchesgetassfucked.mp4
File Size : 214.76 MB
Resolution : 640x360
Duration : 00:06:55

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/3a8c7edad66bc (https://tezfiles.com/file/3a8c7edad66bc)

Tiered
01-17-2022, 12:14 PM
Clubdom.com- Alexis Fawx Michelle Lacy: Caning A Rack Of Meat
https://img119.imagetwist.com/th/44836/fflyj4cotk84.jpg (https://imagetwist.com/fflyj4cotk84/s867alexisfawxmechellelacycaning.jpg)
https://img202.imagetwist.com/th/44836/potd9f9bwx2q.jpg (https://imagetwist.com/potd9f9bwx2q/mDFESLFt.jpg)

Description:
Goddess Alexis Fawx and Mistress Michelle Lacy have their slave give them a ride in the pony cart out to the field where another useless rack of man meat awaits to be sadistically and brutally caned, They pull him from the cage and the caning begins hundreds upon hundreds of brutal cane strokes welt the slaves quivering ass as he screams out for mercy, The ladies just laugh and continue to beat his ass until it welts up looking like a piece of raw meat.
Model:
Alexis Fawx, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s867alexisfawxmechellelacycaning.mp4
File Size : 351.84 MB
Resolution : 1280x720
Duration : 00:07:33

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c018a12cdb724 (https://tezfiles.com/file/c018a12cdb724)

Tiered
01-17-2022, 12:16 PM
Clubdom.com- Horny Mistress Evelin
https://img202.imagetwist.com/th/45074/4l1y3248pgyr.jpg (https://imagetwist.com/4l1y3248pgyr/cd_s1237_evelinstone_tuckerstevens_fucking.jpg)
https://img119.imagetwist.com/th/45074/nj6qtjgrl45z.jpg (https://imagetwist.com/nj6qtjgrl45z/fQGJVNDc.jpg)

Description:
Goddess Evelin Stone is horny. They decide to take the best looking slave and see if he can satisfy her with his huge cock. He isn_t allowed to cum and if he does, he is going to pay. Evelin gets fucked by the huge stud slave while Mistress Tucker commands him to please her friend and make her cum.
Model:
Evelin Stone, Tucker Stevens
Studio:
Clubdom.com
Info:
File Name : cd_s1237_evelinstone_tuckerstevens_fucking.mp4
File Size : 209.18 MB
Resolution : 1280x720
Duration : 00:04:26

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2ab880fc3c6c0 (https://tezfiles.com/file/2ab880fc3c6c0)

Tiered
01-17-2022, 12:16 PM
Clubdom.com- Goddesses Tease You With Strap Ons
https://img119.imagetwist.com/th/45061/sxor0p6xbrf0.jpg (https://imagetwist.com/sxor0p6xbrf0/cd_s1143_goddessdahlia_mistresstangent_pov.jpg)
https://img119.imagetwist.com/th/45061/vuxo3saqx1qd.jpg (https://imagetwist.com/vuxo3saqx1qd/AzwIQTH.jpg)

Description:
Goddess Dahlia Rain and Mistress Tangent are getting wet at the thought of you crawling towards them to suck on their big fat black cocks. The Goddesses are sitting on your cage stroking their beautiful strap on cocks, dreaming of watching you gag and choke on them. Mistress Tangent wants to watch you warm up your man pussy with your fingers so they can fuck your whore ass later with ease. Goddess Dahlia Rain instructs you to taste your cum for her, as they know you are hungry to feel their cocks filling up your ass and throat.
Model:
Dahlia Rain, Goddess Tangent
Studio:
Clubdom.com
Info:
File Name : cd_s1143_goddessdahlia_mistresstangent_pov.mp4
File Size : 267.61 MB
Resolution : 1280x720
Duration : 00:05:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a377f7667ca75 (https://tezfiles.com/file/a377f7667ca75)

Tiered
01-17-2022, 12:17 PM
Clubdom.com- Kicked Until Broken
https://img119.imagetwist.com/th/45072/2wnkk0i5e51h.jpg (https://imagetwist.com/2wnkk0i5e51h/cd_s1224_sashafoxx_reaganlush_ballbusting.jpg)
https://img119.imagetwist.com/th/45072/pn9u4uxu3pwb.jpg (https://imagetwist.com/pn9u4uxu3pwb/lavrcC.jpg)

Description:
Mistress Sasha Foxx and Goddess Reagan Lush have their sub by the balls. They grin as they poke and prod his delicate balls with their fingers. They decide to kick in his balls and do not want to stop until either the slave or his balls are broken The women take turns winding up, giving delicious kicks to these slaves as they destroy his filth sack dangling between his legs. He cannot tolerate the pain and wishes for it to end but the kicks just keep coming.
Model:
Reagan Lush, Sasha Foxx
Studio:
Clubdom.com
Info:
File Name : cd_s1224_sashafoxx_reaganlush_ballbusting.mp4
File Size : 179.51 MB
Resolution : 1280x720
Duration : 00:04:09

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/96dec3a192ecf (https://tezfiles.com/file/96dec3a192ecf)

Tiered
01-17-2022, 12:22 PM
Clubdom.com- Jamie Kimber: Another Boot Slut (POV)
https://img33.imagetwist.com/th/44829/n0aeyaa3hwld.jpg (https://imagetwist.com/n0aeyaa3hwld/s730jamievalentinekimberwoodspovbootlick.jpg)
https://img165.imagetwist.com/th/44829/t60xp7k8ds2l.jpg (https://imagetwist.com/t60xp7k8ds2l/TQopFw.jpg)

Description:
Goddess Jamie Valentine and Kimber Woods Know what a Boot slut you are and they tease you with their Thigh high shiny black boots letting you dream of being close enough to lick the filth from their boots as you jerk your tiny pathetic cock and make a huge white mess all over yourself the ladies make sure you lick up every last drop you boot slut.
Model:
Kimber Woods
Studio:
Clubdom.com
Info:
File Name : s730jamievalentinekimberwoodspovbootlick.mp4
File Size : 217.74 MB
Resolution : 1280x720
Duration : 00:04:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/af897d7dea962 (https://tezfiles.com/file/af897d7dea962)

Tiered
01-17-2022, 12:31 PM
Clubdom.com- Admit You Will Suck Cock
https://img165.imagetwist.com/th/44739/8kcizd2hahhz.jpg (https://imagetwist.com/8kcizd2hahhz/cd_s435_worship_my_strap_on_pov.jpg)
https://img202.imagetwist.com/th/44739/5hwivpl572iv.jpg (https://imagetwist.com/5hwivpl572iv/cd_s435_worship_my_strap_on_pov.mp4.jpg)

Description:
Amadahy knows that you want your sweet little lips wrapped around her giant black cock. Why deny it? She is going to train you to cum only when you have a cock in your throat. So, open up and start stroking that short dick. What is that on your fingers? Is your cocklett sweating? Oh my, you will have to lick your fingers clean and continue to follow Amadahy_s instructions. She is ruthless in making you admit what a cock whore you really are.
Model:
Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_s435_worship_my_strap_on_pov.mp4
File Size : 282.54 MB
Resolution : 1280x720
Duration : 00:06:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/43f7c71f7eec0 (https://tezfiles.com/file/43f7c71f7eec0)

Tiered
01-17-2022, 12:32 PM
Clubdom.com- Ball Pain Gets Jaime Off
https://img202.imagetwist.com/th/44666/6hryov6cgzk1.jpg (https://imagetwist.com/6hryov6cgzk1/cd_04_08_13_cbtpov.jpg)
https://img165.imagetwist.com/th/44666/l0ts2yposng9.jpg (https://imagetwist.com/l0ts2yposng9/cd_04_08_13_cbtpov.mp4.jpg)

Description:
Mistress Jaime loves seeing pathetic slaves suffer in agony for her amusement, especially when it involves their cock and balls. Jaime orders you to tie your cock and balls tight, then commands you to slap your own cock and balls harder and harder, just so she can laugh at you.

When Jaime sees precum oozing out of your abused dick, she decides to give you a cum mustache, laughing at your humiliation. Jaime then orders you to jerk your tied up cock, knowing that every stroke will be causing agony, but knowing that you are so desperate to cum that you will suffer anything for it. Jaime orders you to cum, then makes sure that you eat every drop of it
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cd_04_08_13_cbtpov.mp4
File Size : 253.65 MB
Resolution : 1280x720
Duration : 00:05:20

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/644587c9fde74 (https://tezfiles.com/file/644587c9fde74)

Tiered
01-17-2022, 12:39 PM
Clubdom.com- Inga Victoria: Pussy For Dinner Part 2
https://img202.imagetwist.com/th/45045/mgvqim0nb5hb.jpg (https://imagetwist.com/mgvqim0nb5hb/s9472-3ingavictoriaasslick.jpg)
https://img202.imagetwist.com/th/45045/y2zsmrocn4fm.jpg (https://imagetwist.com/y2zsmrocn4fm/wQqaHAF.jpg)

Description:
Slave 009 is exhausted and has only been fed a few scraps over the past 3 days while Goddess Inga Victoria has him working outside landscaping her new house non-stop. He has been worked hard and collapses from exhaustion and decides to go into the house to beg her for an actual meal. She agrees and has a wonderful dinner prepared on the table for him. Just before she gives him permission to eat, she decides to give him a choice instead....food or her pussy? He cannot help it but choose her pussy as he has been fantasizing about what this would be like ever since she enslaved him 6 months ago. Besides, what if this is what Mistress wants and he chooses food over her? That could be seen as disrespectful. He must choose her. Slave 009 goes to town eating her pussy from every angle she poses her sexy self in and pleasures her as best he can. She tastes so incredible, even better than he could ever fantasize about. She is so wet, he did not know a pussy could taste this good.
Model:
Inga Victoria
Studio:
Clubdom.com
Info:
File Name : s9472-3ingavictoriaasslick.mp4
File Size : 202.83 MB
Resolution : 1280x720
Duration : 00:05:28

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/53399b2a57a2a (https://tezfiles.com/file/53399b2a57a2a)

Tiered
01-17-2022, 12:49 PM
Clubdom.com- Arena Rome Dominates
https://img119.imagetwist.com/th/45058/kkd12vfrsg25.jpg (https://imagetwist.com/kkd12vfrsg25/cd_s1110_full_arenarome_minimovie.jpg)
https://img119.imagetwist.com/th/45058/mnje7v3hwqfw.jpg (https://imagetwist.com/mnje7v3hwqfw/coOdJor.jpg)

Description:
Queen Arena Rome drags her slave into her dungeon and forces his legs apart. She then gets a running start to kick him in his useless slut sacks. Queen Arena drags her slave around and uses her hands and feet to bust his fucking balls. Queen Arena Rome has her slave on her St. Andrew_s Cross and forces him to beg to be whipped. When Queen Arena is convinced her slave wants to feel the sting of her whip, she proceeds to lash his pale white back. Her slave cries out in pain while being whipped until his back is bright red. Queen Arena Rome has her pathetic slave bent over his cage and ready to get caned. Queen Arena makes him count the number of times his bare ass has been caned while she punishes her slave. Queen Arena Rome has been having fun punishing her slave, and is craving some pussy attention. Of course her pathetic slave will never be able to satisfy her, or even touch her wet pussy. Queen Arena makes her slave wear a chindo to fuck her with. She grabs the back of his head to help him fuck her pussy. Queen Arena Rome makes her slave lube up her strap on before she fucks his tight man pussy. When her big black cock is lubed up enough, Queen Arena bends her slave over and shoves her cock in his ass.
Model:
Arena Rome
Studio:
Clubdom.com
Info:
File Name : cd_s1110_full_arenarome_minimovie.mp4
File Size : 1549.3 MB
Resolution : 1280x720
Duration : 00:32:43

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/09fc7c2aeae32 (https://tezfiles.com/file/09fc7c2aeae32)

Tiered
01-17-2022, 12:49 PM
Clubdom.com- Dungeon Trick and Restrain
https://img202.imagetwist.com/th/45059/pelsj647rlbj.jpg (https://imagetwist.com/pelsj647rlbj/cd_s1121_1-4_mistressdahlia_dominahelena_whipping.jpg)
https://img119.imagetwist.com/th/45059/9f5gf2m11mct.jpg (https://imagetwist.com/9f5gf2m11mct/RinbcrA.jpg)

Description:
Mistress Dahlia and Domina Helena use their slave to give them a ride to their dungeon where they restrain him so they can whip him. They take turns turning his pale white back red with whip marks. Dressed in their latex stockings, they admire their artwork before deciding they need to work a little lower on their slave.
Model:
Dahlia Rain, Domina Helena
Studio:
Clubdom.com
Info:
File Name : cd_s1121_1-4_mistressdahlia_dominahelena_whipping.mp4
File Size : 352.47 MB
Resolution : 1280x720
Duration : 00:07:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/68e04a8182b3f (https://tezfiles.com/file/68e04a8182b3f)

Tiered
01-17-2022, 12:52 PM
Clubdom.com- Sarah Dise: Caning Her Slut
https://img119.imagetwist.com/th/44835/xtpdrenp2n33.jpg (https://imagetwist.com/xtpdrenp2n33/s867sarahdicecaning.jpg)
https://img119.imagetwist.com/th/44835/v4cggo89gmgl.jpg (https://imagetwist.com/v4cggo89gmgl/GLyGiM.jpg)

Description:
Goddess Sarah Dise feels like getting in her workout for the day so she leads slave 227 over to the stock and tell him to beg for her cane, She canes him brutally and hard telling him this is what pleases her, and that he will learn to love being her pain slut.
Model:
Sarah Dise
Studio:
Clubdom.com
Info:
File Name : s867sarahdicecaning.mp4
File Size : 318.05 MB
Resolution : 1280x720
Duration : 00:06:43

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4dbd732922c43 (https://tezfiles.com/file/4dbd732922c43)

Tiered
01-17-2022, 12:59 PM
Clubdom.com- Don_t Ruin Our Fun
https://img202.imagetwist.com/th/44665/cnhvykembmot.jpg (https://imagetwist.com/cnhvykembmot/cd_05_04_13_ballbusting.jpg)
https://img119.imagetwist.com/th/44665/z0thhgdo5f4v.jpg (https://imagetwist.com/z0thhgdo5f4v/cd_05_04_13_ballbusting.mp4.jpg)

Description:
Goddess Amadahy and Mistress Elena drag a stable bitch outdoors for some heavy ballbusting. The Mistresses truly enjoy torturing balls and demand that their bitch take whatever they want to dish out.

Amadahy and Elena show the bitch no mercy, delivering several full force running kicks from the front and the back, ordering the bitch to stand back up every time he fall just so they can kick him again. Amadahy laughs at the bitch as she warns him again and again, Don_t ruin our fun after he falls. Just when the bitch thinks his ordeal is over, Amadahy delivers one last crushing kick to send him to the ground. Slaves in agonizing pain is exactly the fun these sadistic Mistresses enjoy.
Model:
Elena Sin, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_05_04_13_ballbusting.mp4
File Size : 319.97 MB
Resolution : 1280x720
Duration : 00:06:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/77e8a5fe91131 (https://tezfiles.com/file/77e8a5fe91131)

Tiered
01-17-2022, 01:01 PM
Clubdom.com- Ball Busting Handjob
https://img119.imagetwist.com/th/44721/7ws40ar1cg4j.jpg (https://imagetwist.com/7ws40ar1cg4j/ballbustinghandjob.jpg)
https://img119.imagetwist.com/th/44721/29i89zp9nzji.jpg (https://imagetwist.com/29i89zp9nzji/ballbustinghandjob.mp4.jpg)

Description:
Mistress Kimylee and Goddess Brianna strap a male bitch into a bondage chair. The ladies are feeling particularly sadistic and begin tormenting this helpless slut. They stroke his cock, forcing him to become hard. Brianna laughs as the slut becomes rock hard. She takes him right to the edge and then stops. The slave is terrified. He knows that if he shoots his male filth, the ladies will kick him in the balls. He tries to hold back but is no match for their soft hands. Sure enough, as soon as the slut cums, BAM Brianna nails him right in the balls with full force. What a way to ruin an orgasm
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : ballbustinghandjob.mp4
File Size : 235.05 MB
Resolution : 1280x720
Duration : 00:06:25

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0e4a9f560e8fc (https://tezfiles.com/file/0e4a9f560e8fc)

Tiered
01-17-2022, 01:03 PM
Clubdom.com- Whipping Video - Never Released
https://img119.imagetwist.com/th/45083/n0ppailrw0ez.jpg (https://imagetwist.com/n0ppailrw0ez/cd_s233_whiping.jpg)
https://img119.imagetwist.com/th/45083/0q8kn8qpqxvw.jpg (https://imagetwist.com/0q8kn8qpqxvw/oPkHyCFG.jpg)

Description:
Never Released Can any of you name the Mistress that is in this vintage video? I bet some of you remember her very fondly and her cruelty
Model:
Shae Fatale, shae Fatale
Studio:
Clubdom.com
Info:
File Name : cd_s233_whiping.mp4
File Size : 310.19 MB
Resolution : 1280x720
Duration : 00:06:32

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/14d85e86edcab (https://tezfiles.com/file/14d85e86edcab)

Tiered
01-17-2022, 01:04 PM
Clubdom.com- Sissy Fucked by Miss Roper
https://img202.imagetwist.com/th/45185/tr2n4a84aemc.jpg (https://imagetwist.com/tr2n4a84aemc/cd_s1375_raquelroper_sissystrapon.jpg)
https://img119.imagetwist.com/th/45185/caq5itg9abat.jpg (https://imagetwist.com/caq5itg9abat/keKaVm.jpg)

Description:
Miss Ropers sissy slave has taken his punishment and his ass is now the proper shade of red. Its time for the slut to get his ass fucking. Miss Roper has her bitch on his knees in front of her. She shoves her fingers in his mouth as she tells him how she is about to make his slutty dreams a reality. But before he can take Miss Ropers cock, he will have to beg for it. After properly begging for Miss Ropers cock, she allows her slut to suck on it. Miss Roper makes him drool and slobber all over her shaft, as she forces him to deep throat her huge cock. Now its time for the fucking Miss Roper wants to make sure this slut never forgets her cock. She slams her hips with her cock into her helpless slaves ass. She laughs and smiles, the deeper she rams her huge cock into her screaming slaves ass. There is no doubt that Miss Roper owns this whore completely. Especially his slutty ass
Model:
Miss Roper
Studio:
Clubdom.com
Info:
File Name : cd_s1375_raquelroper_sissystrapon.mp4
File Size : 330.67 MB
Resolution : 1280x720
Duration : 00:06:51

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e9c0e8295aea3 (https://tezfiles.com/file/e9c0e8295aea3)

Tiered
01-17-2022, 01:13 PM
Clubdom.com- Kylie Rogue Michelle Lacy StrapOn
https://img119.imagetwist.com/th/44835/fotwmv6hdqdh.jpg (https://imagetwist.com/fotwmv6hdqdh/s853kylieroguemichellelacystrapon1.jpg)
https://img69.imagetwist.com/th/44835/8ewo8p97wzyi.jpg (https://imagetwist.com/8ewo8p97wzyi/sXWuaSwx.jpg)

Description:
Michelle Lacy feels Like stretching some boy pussy and makes strap on boy crawl over to her with the fuck horse on top of him then rams her 12 inch hard black cock in his mouth and tells him to slather it up so she can fuck his pathetic boy pussy ass he begs for more she fills his ass cavity with all 12 inches, ramming her cock in deeper and harder than ever before.
Model:
Kylie Rogue, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s853kylieroguemichellelacystrapon1.mp4
File Size : 317.69 MB
Resolution : 1280x720
Duration : 00:06:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6fb06a0bf6ec1 (https://tezfiles.com/file/6fb06a0bf6ec1)

Tiered
01-17-2022, 01:25 PM
Clubdom.com- Jamie Valentine: Whipped by his Goddess
https://img119.imagetwist.com/th/45049/ky0lqrjy9xuo.jpg (https://imagetwist.com/ky0lqrjy9xuo/YkxvlRR.jpg)
https://img119.imagetwist.com/th/45049/9qbykc9wju60.jpg (https://imagetwist.com/9qbykc9wju60/ftcNgL.jpg)

Description:
Jamie Valentine decides it is whipping day for her slave. He must endure everything she dishes out. she is determined to turn her white fleshy canvas, bright shades of red. She eats his flesh with a stinging galley whip as he cringes and groans. It_s too bad, there are no breaks here at Clubdom slave. He must continue to suffer More and more strikes she delivers. After a while, the laughing, smiling sadist switches to a black single tail, and she uses it with precision to deliver sharp blows to his back.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : CD_S988_JamieValentine_WhippingBart.mp4
File Size : 1376.68 MB
Resolution : 1920x1080
Duration : 00:09:04

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/17eaae0283903 (https://tezfiles.com/file/17eaae0283903)

Tiered
01-17-2022, 01:30 PM
Clubdom.com- Fuck That Tight Pussy
https://img165.imagetwist.com/th/44654/qc215z971eic.jpg (https://imagetwist.com/qc215z971eic/cd_12_30_12_strapon2.jpg)
https://img33.imagetwist.com/th/44655/jnqzk4vcnlid.jpg (https://imagetwist.com/jnqzk4vcnlid/cd_12_30_12_strapon2.mp4.jpg)

Description:
Goddess Brianna makes her slut beg for her cock, then fucks his tight pussyhole with it until he is moaning and groaning in pain.
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : cd_12_30_12_strapon2.mp4
File Size : 53.53 MB
Resolution : 640x360
Duration : 00:06:40

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/eb834fa10004e (https://tezfiles.com/file/eb834fa10004e)

Tiered
01-17-2022, 01:30 PM
Clubdom.com- Cumming For Goddess Isobel Devi
https://img119.imagetwist.com/th/45040/3s8dl10av75s.jpg (https://imagetwist.com/3s8dl10av75s/s894michellelacynatalyasadiciisobeldevillydiasupre macyisobeldevilpov.jpg)
https://img202.imagetwist.com/th/45040/20h46run55mb.jpg (https://imagetwist.com/20h46run55mb/OzHgNcy.jpg)

Description:
Goddess Isobel Devi knows what a little pathetic jerk off slut you are always got your hand in your pants touching that tiny micro penis hoping to one day impress a Goddess enough to to make her slap you right across the face pull your pants down, bend you over and shove a big 13 inch black strap on cock in your boy pussy and pound you hard and deep as you stroke that tiny excuse you have for a cock and dribble little sprinkles of disgusting man filth all over yourself then beg to be fucked with your own cum and be laughed at and humiliated over and over maybe one day even getting to wear lipstick and have two Domes fill your face hole and but hole and fuck you over and over again in every degrading way posable, Because you are a sorry excuse for a human being who only wishes to be owned and used loser. Now go ahead and spill your filth cucky
Model:
Isobel Devi
Studio:
Clubdom.com
Info:
File Name : s894michellelacynatalyasadiciisobeldevillydiasupre macyisobeldevilpov.mp4
File Size : 276.17 MB
Resolution : 1280x720
Duration : 00:05:53

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/96f94868a32fd (https://tezfiles.com/file/96f94868a32fd)

Tiered
01-17-2022, 01:34 PM
Clubdom.com- Tangent_s Toilet
https://img119.imagetwist.com/th/45072/fzqftr7bjubp.jpg (https://imagetwist.com/fzqftr7bjubp/cd_s1220_tangent_peepov.jpg)
https://img119.imagetwist.com/th/45072/53zy8lekw1id.jpg (https://imagetwist.com/53zy8lekw1id/qfQjNdw.jpg)

Description:
You are underneath Goddess Tangent and ready to be her toilet slave. Are you ready to drink from her? Are you ready for your golden opportunity? I bet you are. Open wide and swallow each and every drop. You do want to please Goddess Tangent, don_t you slave? Good boy. That_s it, drink it all.
Model:
Goddess Tangent
Studio:
Clubdom.com
Info:
File Name : cd_s1220_tangent_peepov.mp4
File Size : 374.73 MB
Resolution : 1280x720
Duration : 00:07:54

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0f51855b2a68d (https://tezfiles.com/file/0f51855b2a68d)

Tiered
01-17-2022, 01:37 PM
Clubdom.com- Grovelling Boot Whore
https://img33.imagetwist.com/th/44655/lowe4rnc47jv.jpg (https://imagetwist.com/lowe4rnc47jv/cd_01_13_13_bootworship.jpg)
https://img33.imagetwist.com/th/44655/8z6zuyuiqog3.jpg (https://imagetwist.com/8z6zuyuiqog3/cd_01_13_13_bootworship.mp4.jpg)

Description:
Mistresses Jean, Coral, and Amadahy have their boots worshipped and cleaned by a boot whore, laughing as he grovels before them trying to clean their dirty boots with his tongue.
Model:
Coral, Goddess Amadahy, Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_01_13_13_bootworship.mp4
File Size : 52.42 MB
Resolution : 640x360
Duration : 00:06:34

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a22d73c47b2ac (https://tezfiles.com/file/a22d73c47b2ac)

Tiered
01-17-2022, 01:40 PM
Clubdom.com- Tiny Dick Humiliation (POV)
https://img69.imagetwist.com/th/44832/zh4yifeh5s0g.jpg (https://imagetwist.com/zh4yifeh5s0g/s782calliecalypsopovsmalldick.jpg)
https://img202.imagetwist.com/th/44832/23hlpkekcv6e.jpg (https://imagetwist.com/23hlpkekcv6e/jPAtPQTu.jpg)

Description:
Goddess Callie Calypso has you down on your knees and knows you are getting a 2 Inch tiny boner in your pants, She teases and torments you with her sexy body as she laughs at you stroking that pathetic excuse for cock, She lets you use your thumb and index finger and rub one out squirting white goo all over yourself and then makes you scoop it up and eat it.
Model:
Callie Calypso
Studio:
Clubdom.com
Info:
File Name : s782calliecalypsopovsmalldick.mp4
File Size : 309.64 MB
Resolution : 1280x720
Duration : 00:06:31

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f37b4cc49c153 (https://tezfiles.com/file/f37b4cc49c153)

Tiered
01-17-2022, 01:43 PM
Clubdom.com- Goddess Cheyenne Jean Bardot StrapOn POV
https://img202.imagetwist.com/th/45056/xn7hew2wa32t.jpg (https://imagetwist.com/xn7hew2wa32t/cd_s1102_goddesscheyenne_mistressjeanbardot_strapo npov.jpg)
https://img202.imagetwist.com/th/45056/6d0f05i778hm.jpg (https://imagetwist.com/6d0f05i778hm/IxNdCAA.jpg)

Description:
Goddess Cheyenne and Mistress Jean Bardot are talking down to their strap on slut who is drooling over their big black strap on cocks. They tease you by showing off their big dicks while telling you exactly what they will do to you.
Model:
Goddess Cheyenne, January Seraph
Studio:
Clubdom.com
Info:
File Name : cd_s1102_goddesscheyenne_mistressjeanbardot_strapo npov.mp4
File Size : 339.2 MB
Resolution : 1280x720
Duration : 00:07:10

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4f5d588ab1edb (https://tezfiles.com/file/4f5d588ab1edb)

Tiered
01-17-2022, 01:52 PM
Clubdom.com- Amadahy RULES tiny dick
https://img69.imagetwist.com/th/44737/pt6jgjqo30o6.jpg (https://imagetwist.com/pt6jgjqo30o6/amadahywrestlemini.jpg)
https://img33.imagetwist.com/th/44737/i1lbbvaivn4j.jpg (https://imagetwist.com/i1lbbvaivn4j/amadahywrestlemini.mp4.jpg)

Description:
FULL LENGTH * DVD* Amadahy summons tiny dick for a second round. This time she not only has wrestling on her mind but a bit more in regard to taking away the two inch masculinity he delusionally holds onto. The stunning Goddess Amadahy begins by stretching her perfect feet and strong arms. She is smiling as she knows she is going to utterly humiliate tiny dick. What follows is a series of sadness for all men with big egos and small cocklets. She wrestles him fair and square, putting him, expertly in scissor holds, taking him down beyond the point he can even hope to tap out. She completely rules him on the mat, choking him with her strong thighs until his face is beat read. Amadahy loves the physical and emotional power she has over this tiny dick loser. She notices that he is actually sporting a 2 inch woody. This amuses her greatly. She makes the little slut stroke his short dicklet as she keeps him in a full nelson. Ha ha. Would that small amount of spermlet even fill up a tea spoon? Probably not Just when tiny dick thinks his absolute humiliation is over, Amadahy drags him by the pool, straps on a thick black cock and fucks him in his man pussy until he cries. Oh, goes this stunning Goddess rule over pathetic men
Model:
Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : amadahywrestlemini.mp4
File Size : 926.17 MB
Resolution : 1280x720
Duration : 00:19:34

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ed3a70560a063 (https://tezfiles.com/file/ed3a70560a063)

Tiered
01-17-2022, 01:56 PM
Clubdom.com- Alexis Fawx Pussy Tease Caning
https://img119.imagetwist.com/th/44831/cljbsyuhqqbd.jpg (https://imagetwist.com/cljbsyuhqqbd/s791alexisfawxpussyteasecaining.jpg)
https://img119.imagetwist.com/th/44831/2yjhn1pcxz9s.jpg (https://imagetwist.com/2yjhn1pcxz9s/NUErsy.jpg)

Description:
Goddess Alexis Fawx is cruel and sadistic she leads her slave into the dungeon so she has his filthy slut balls locked into the humbler and tells this slut she should just rip them off, He must prove to her that he is worthy, She teases him with her pussy letting him smell and look at it, Then makes him beg for a merciless beating, She then proceeds to administer an evil caning completely shredding this bitch_s ass like you have never seen, This is what makes her wet and fills her with pleaser is your pathetic suffering, Your only purpose on earth, is to please your Goddess.
Model:
Alexis Fawx
Studio:
Clubdom.com
Info:
File Name : s791alexisfawxpussyteasecaining.mp4
File Size : 479.77 MB
Resolution : 1280x720
Duration : 00:10:08

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f7a714f4dd783 (https://tezfiles.com/file/f7a714f4dd783)

Tiered
01-17-2022, 02:05 PM
Clubdom.com- Double Anal Stretch
https://img119.imagetwist.com/th/45065/9pyuku8igvde.jpg (https://imagetwist.com/9pyuku8igvde/cd_s664_jamie_valentine_doublestrapon.jpg)
https://img202.imagetwist.com/th/45065/o2jt76pcy8sp.jpg (https://imagetwist.com/o2jt76pcy8sp/oZuxSo.jpg)

Description:
Mistress Jame Valentine and Goddess Kylie Rogue just Love to stretch out your ass, they strap up with 12\ inch black strap-ons and fuck your pathetic slave ass until you beg for more, After they have finished stretching your anal cavity to its maximum potential they instruct you to clean your ass off their cocks with you mouth and leave you begging for more.
Model:
Jamie Valentine, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : cd_s664_jamie_valentine_doublestrapon.mp4
File Size : 253.77 MB
Resolution : 1280x720
Duration : 00:05:22

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6e266f941dfba (https://tezfiles.com/file/6e266f941dfba)

Tiered
01-17-2022, 02:14 PM
Clubdom.com- Punished By the Fur Mistress
https://img202.imagetwist.com/th/45045/k1mfrlr6mygk.jpg (https://imagetwist.com/k1mfrlr6mygk/furcoatotkspanking.jpg)
https://img202.imagetwist.com/th/45045/ddr43ns4g448.jpg (https://imagetwist.com/ddr43ns4g448/xRstMx.jpg)

Description:
Mistress Aleana is angry and calls her slave boy over and drags him over her knee. She torments him with how good her fur coat feels on his skin but it turns out, he does not deserve that pleasure, he deserves a severe OTK punishment for leaving her beautiful fur coat on the floor and not taking it to the dry cleaners. He tries to plea but he knows he is wrong and she dishes out a very harsh OTK that he will not soon forget, making his ass more and more red with each heavy swat and leg locking him into position so he cannot get away.
Model:
Alina Long
Studio:
Clubdom.com
Info:
File Name : Furcoatotkspanking.mp4
File Size : 137.27 MB
Resolution : 1280x720
Duration : 00:05:52

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ce373fa98dc17 (https://tezfiles.com/file/ce373fa98dc17)

Tiered
01-17-2022, 02:16 PM
Clubdom.com- Painful Milking Day for Slave 0227
https://img202.imagetwist.com/th/45077/db6pocvj3rj1.jpg (https://imagetwist.com/db6pocvj3rj1/cd_s1283_vanessacage_milking.jpg)
https://img202.imagetwist.com/th/45077/0gg96tyn8bhf.jpg (https://imagetwist.com/0gg96tyn8bhf/CshVcj.jpg)

Description:
Goddess Vanessa Cage tells her slave that today is the day he gets drained. Surely, that would be delightful for most men to hear, but not slaves at Club Dom as they are put through torment in order to do so. Goddess Vanessa is in a sadistic mood and she has her slaves balls tied up so tight as she milks his cock dry. His balls are almost purple as she milks him and it makes her happy to see him in pain.
Model:
Vanessa Cage
Studio:
Clubdom.com
Info:
File Name : cd_s1283_vanessacage_milking.mp4
File Size : 302.04 MB
Resolution : 1280x720
Duration : 00:06:22

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ff026297d2adc (https://tezfiles.com/file/ff026297d2adc)

Tiered
01-17-2022, 02:18 PM
Clubdom.com- Hungry for Ball Busting
https://img119.imagetwist.com/th/45176/4os5fuk9eizu.jpg (https://imagetwist.com/4os5fuk9eizu/movie253cfs.jpg)
https://img202.imagetwist.com/th/45176/k0upz9odbp5l.jpg (https://imagetwist.com/k0upz9odbp5l/GijgfA.jpg)

Description:
This is quite possibly the best ball busting video we_ve made yet. Lady Cheyenne and Mistress A_IE have their slave restrained, spread eagle. They lay into their slave with direct blows to his exposed balls. As one lady kicks the slave dead on, the other watches, anxiously awaiting her turn. It turns into a ball busting frenzy. There is kick after kick with no recovery time for the slave_s aching balls. Cheyenne and A_IE simply are simply radiant. The more they bust the slave_s balls, the hotter they become for more.
Model:
AIE
Studio:
Clubdom.com
Info:
File Name : movie253cfs.mp4
File Size : 57.1 MB
Resolution : 640x480
Duration : 00:04:51

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b9c80822c22f8 (https://tezfiles.com/file/b9c80822c22f8)

Tiered
01-17-2022, 02:26 PM
Clubdom.com- Lydia Heard you Were Desparate POV
https://img119.imagetwist.com/th/45054/oex4rndfdta8.jpg (https://imagetwist.com/oex4rndfdta8/cd_s1092_dahliarain_lydiasupremacy_pov.jpg)
https://img202.imagetwist.com/th/45054/l59hu4xgk57c.jpg (https://imagetwist.com/l59hu4xgk57c/EgZiTJks.jpg)

Description:
Goddess Lydia Supremacy heard you desparately want to worship her latex covered body. Before you can touch Goddess Lydia or her latex bodysuit, she has a few tasks for you to complete. She wants you to finger your man pussy for her. If you prove you can follow her instructions perfectly, maybe Goddess Lydia will allow you to touch her latex body once or twice.
Model:
Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : cd_s1092_dahliarain_lydiasupremacy_pov.mp4
File Size : 248.11 MB
Resolution : 1280x720
Duration : 00:05:16

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4db4f0e83e9f1 (https://tezfiles.com/file/4db4f0e83e9f1)

Tiered
01-17-2022, 02:36 PM
Clubdom.com- Stevie Electroshock Ass Worhip
https://img33.imagetwist.com/th/44746/tqrwzuk2m9io.jpg (https://imagetwist.com/tqrwzuk2m9io/s488_stevie_shae_ass_worship.jpg)
https://img33.imagetwist.com/th/44746/qel1qm1hy1xt.jpg (https://imagetwist.com/qel1qm1hy1xt/s488_stevie_shae_ass_worship.mp4.jpg)

Description:
Watch as Mistress Stevie Electroshocks guy and gets her ass worshiped.
Model:
Stevie Shae
Studio:
Clubdom.com
Info:
File Name : s488_stevie_shae_ass_worship.mp4
File Size : 372.08 MB
Resolution : 1280x720
Duration : 00:07:49

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f5ebfb0feeb86 (https://tezfiles.com/file/f5ebfb0feeb86)

Tiered
01-17-2022, 02:44 PM
Clubdom.com- Black Strap-on Cock Fucking
https://img202.imagetwist.com/th/45058/goddlcld3xqw.jpg (https://imagetwist.com/goddlcld3xqw/cd_s1124_dominahelena_strapon.jpg)
https://img119.imagetwist.com/th/45058/32tif3so8g2z.jpg (https://imagetwist.com/32tif3so8g2z/pthdHNXz.jpg)

Description:
Domina Helena grabs her slave by the head and forces him to lube up her black strap on cock with his spit. Domina Helena then pushes her hands into his man pussy to prepare it so she can fuck her slutty slave. She then slides her big cock deep into her slave_s man pussy and begins pegging her useless slave.
Model:
Dahlia Rain, Domina Helena
Studio:
Clubdom.com
Info:
File Name : cd_s1124_dominahelena_strapon.mp4
File Size : 380.19 MB
Resolution : 1280x720
Duration : 00:08:03

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6b14a3e5a59e9 (https://tezfiles.com/file/6b14a3e5a59e9)

Tiered
01-17-2022, 02:46 PM
Clubdom.com- Stretched and Croped Part 1
https://img119.imagetwist.com/th/45084/c41bbyykydyb.jpg (https://imagetwist.com/c41bbyykydyb/EqZSiyg.jpg)
https://img119.imagetwist.com/th/45084/wx4c8m6wcnxj.jpg (https://imagetwist.com/wx4c8m6wcnxj/XLPAlWmj.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie498.wmv
File Size : 17.88 MB
Resolution : 320x240
Duration : 00:04:49

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6c0c239a11e52 (https://tezfiles.com/file/6c0c239a11e52)

Tiered
01-17-2022, 02:54 PM
Clubdom.com- Double Penetration
https://img119.imagetwist.com/th/45172/zth962np54i5.jpg (https://imagetwist.com/zth962np54i5/movie336cfs.jpg)
https://img202.imagetwist.com/th/45172/a1ghhd6ijg2d.jpg (https://imagetwist.com/a1ghhd6ijg2d/NUARBC.jpg)

Description:
Cheyenne calls her chastity slave over to her bed. She tells him that she_s been dying to fuck him. After 30 days in chastity his load must be huge. The slave can barely believe his eyes. Certainly Mistress is not inviting him into her bed. Soon the slave finds out exactly how Mistress wants to fuck him. Cheyenne puts her bitch on his back and drives her 10 inch cock into his ass. Then she fucks is cock with a steel rod. I love double penetration Cheyenne says as she fills up all of her slut_s holes. Cheyenne tells her slave that the only way he_ll ever be allowed to cum from on out is with her cock in his ass. She puts a vibrator on the slave_s cock and forces him to give himself a dirty cum bath. Then she force feeds her slave his nasty male filth.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie336cfs.mp4
File Size : 53.98 MB
Resolution : 640x480
Duration : 00:04:36

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/3ecbaacc091c2 (https://tezfiles.com/file/3ecbaacc091c2)

Tiered
01-17-2022, 02:54 PM
Clubdom.com- Sex Slave For Blondes Part 4: Hardcore Milking
https://img119.imagetwist.com/th/45047/dkl9012p41dm.jpg (https://imagetwist.com/dkl9012p41dm/cd_s952_alexisfawx_parkerswayze_milking.jpg)
https://img119.imagetwist.com/th/45047/pn8wlzowahon.jpg (https://imagetwist.com/pn8wlzowahon/ELRWTH.jpg)

Description:
The hot blonde duo is back and they have new slaves to use. This time they are milking the newest slave in their stable. First they edge him for what feels like forever. He learns who owns and controls him very quickly The two Dommes then take him right back to the edge and finally milk every last drop, completely draining him. Of course they make him eat it and smear the rest all over his pathetic face.
Model:
Alexis Fawx, Parker Swayze
Studio:
Clubdom.com
Info:
File Name : cd_s952_alexisfawx_parkerswayze_milking.mp4
File Size : 334.27 MB
Resolution : 1280x720
Duration : 00:07:02

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d429017781504 (https://tezfiles.com/file/d429017781504)

Tiered
01-17-2022, 03:02 PM
Clubdom.com- Strapon Husband Training
https://img202.imagetwist.com/th/45074/dnmxp4rji9lw.jpg (https://imagetwist.com/dnmxp4rji9lw/cd_s1232_brianna_parisknight_strapon.jpg)
https://img119.imagetwist.com/th/45074/ft40fq8qxc33.jpg (https://imagetwist.com/ft40fq8qxc33/qTEqHb.jpg)

Description:
Goddess Brianna and Paris Knight want to show Paris_ husband that he is going to be the best behaved husband Paris has ever seen. As part of his training as well as his punishment for being unsatisfactory, the women decide to fuck him good and hard with their strap-ons. He first is made to suck their cocks, humiliating enough all on its own. Now he must bend over and get it good from his wife, as she happily plows his hole.
Model:
Goddess Brianna, Paris Knight
Studio:
Clubdom.com
Info:
File Name : cd_s1232_brianna_parisknight_strapon.mp4
File Size : 300.54 MB
Resolution : 1280x720
Duration : 00:06:20

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/49082f3a4344a (https://tezfiles.com/file/49082f3a4344a)

Tiered
01-17-2022, 03:06 PM
Clubdom.com- Lydia Kylie Rogue StrapOn Fucking
https://img119.imagetwist.com/th/44835/7x4dgfxck6qe.jpg (https://imagetwist.com/7x4dgfxck6qe/s845lydiasupremacykylieroguestrapon.jpg)
https://img202.imagetwist.com/th/44835/5ghfoy12t9xj.jpg (https://imagetwist.com/5ghfoy12t9xj/ewnmDBaM.jpg)

Description:
Mistress Kylie Rogue drags the pathetic strapon slut who is about to get pounded, into the ClubDom dungeon with the help of Lydia Supremacy. She can_t resist sharing the stretched man-pussy so the Mistresses take turns sadistically shoving into the slaves ass. The Brutality keeps building as each Mistress mercilessly slams their strapon to the hilt leaving the filthy slut hole gaping for the other to slide into.
Model:
Kylie Rogue, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s845lydiasupremacykylieroguestrapon.mp4
File Size : 274.21 MB
Resolution : 1280x720
Duration : 00:05:51

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c16e5bd021bf8 (https://tezfiles.com/file/c16e5bd021bf8)

Tiered
01-17-2022, 03:07 PM
Clubdom.com- 14 Month Milking Day
https://img119.imagetwist.com/th/45044/p9gh7o0w36ji.jpg (https://imagetwist.com/p9gh7o0w36ji/s918ravenisobelrickymilking.jpg)
https://img119.imagetwist.com/th/45044/xychyeuw6eku.jpg (https://imagetwist.com/xychyeuw6eku/eYpLBCW.jpg)

Description:
Goddess Isobel Devi decrees that this slave is to be milked. It_s been so long the slave does not even remember the last time he was allowed to cum. Mistress Raven and Mistress Ricky get to work stroking his huge throbbing frustrated cock. He_s almost afraid to cum. Finally he is drained of every single worthless drop. Maybe now he will perform his tasks better until his next milking. Will it be another 14 months?
Model:
Isobel Devi
Studio:
Clubdom.com
Info:
File Name : s918ravenisobelrickymilking.mp4
File Size : 361.01 MB
Resolution : 1280x720
Duration : 00:06:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ccc220a1b21b6 (https://tezfiles.com/file/ccc220a1b21b6)

Tiered
01-17-2022, 03:12 PM
Clubdom.com- Tiny Dick Boot Humping
https://img202.imagetwist.com/th/44654/s5t4l0vk47l9.jpg (https://imagetwist.com/s5t4l0vk47l9/cd_12_30_12_bootjerk.jpg)
https://img33.imagetwist.com/th/44654/6t6rs6d262v8.jpg (https://imagetwist.com/6t6rs6d262v8/cd_12_30_12_bootjerk.mp4.jpg)

Description:
Goddess Brianna can_t help but laugh at her slave_s tiny dick, half the size of her boot heel. After making merciless fun of his shortcomings, Brianna orders her slave to fuck boots, then jerk off his little cock on her boots. The slave succeeds in actually producing a cum load from his tiny cock, which Brianna orders him to lick clean from her boots.
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : cd_12_30_12_bootjerk.mp4
File Size : 52.85 MB
Resolution : 640x360
Duration : 00:06:38

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/3b7b5af8b3558 (https://tezfiles.com/file/3b7b5af8b3558)

Tiered
01-17-2022, 03:13 PM
Clubdom.com- Auction Slave Boot Cleaning
https://img202.imagetwist.com/th/45043/9buy221pbweo.jpg (https://imagetwist.com/9buy221pbweo/s908nataliaparismichellelacyboothlicking.jpg)
https://img119.imagetwist.com/th/45043/hfviifdoz8kw.jpg (https://imagetwist.com/hfviifdoz8kw/zIWzVQR.jpg)

Description:
Mistress Michelle Lacy has slaves up for auction and Goddesses Natalie Starr and Paris Knight are two potential buyers. The Ladies want to know what the slaves are capable of, so Michelle has her bitch clean the Ladies boots with his tongue while Michelle discusses his other uses, like taking a whipping and cleaning whatever he is told. The Ladies are impressed enough with the slave_s boot licking abilities that they decide to try him out for some more tasks before they might buy him.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s908nataliaparismichellelacyboothlicking.mp4
File Size : 248.97 MB
Resolution : 1280x720
Duration : 00:05:18

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/796ac3662b2ab (https://tezfiles.com/file/796ac3662b2ab)

Tiered
01-17-2022, 03:20 PM
Clubdom.com- Strap-on Queens
https://img119.imagetwist.com/th/45075/nbmr90tccotb.jpg (https://imagetwist.com/nbmr90tccotb/cd_s1231_brianna_parisknight_straponpov.jpg)
https://img119.imagetwist.com/th/45075/ksk88ojrlngt.jpg (https://imagetwist.com/ksk88ojrlngt/rMTDuIPf.jpg)

Description:
Goddess Brianna and Paris Knight are strap-on queens and they are here to shove their big cocks in your slut-holes. You know you want your pathetic holes filled by both of those women. You need it, you crave it, and these women are here to give it to you and remind you of who owns your pathetic ass. Listen to what they have to say and train yourself with your own dildo at home.
Model:
Goddess Brianna, Paris Knight
Studio:
Clubdom.com
Info:
File Name : cd_s1231_brianna_parisknight_straponpov.mp4
File Size : 236.38 MB
Resolution : 1280x720
Duration : 00:04:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/100d2a7b5f078 (https://tezfiles.com/file/100d2a7b5f078)

Tiered
01-17-2022, 03:22 PM
Clubdom.com- Alexis Fawx Michelle Lacy: Ass Fucking The Slut
https://img69.imagetwist.com/th/44836/oseqjjroday1.jpg (https://imagetwist.com/oseqjjroday1/s871alexisfawxmechellelacystrapon.jpg)
https://img69.imagetwist.com/th/44836/z9ynp72ayr35.jpg (https://imagetwist.com/z9ynp72ayr35/iAVmbMJo.jpg)

Description:
Goddess Alexis Fawx and Mistress Michelle Lacy have decided to pound some slave ass today, So they bend the pathetic slit over the pony cart and ram their 13 inch hard black strap on cocks up the slaves man pussy pounding him hard and fast the ladies take turns stretching the slaves anus wide open.
Model:
Alexis Fawx, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s871alexisfawxmechellelacystrapon.mp4
File Size : 332.12 MB
Resolution : 1280x720
Duration : 00:06:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ee462740e5a74 (https://tezfiles.com/file/ee462740e5a74)

Tiered
01-17-2022, 03:32 PM
Clubdom.com- Nikki Brook and Santa_s Boot
https://img119.imagetwist.com/th/45054/1v1tk5exo97v.jpg (https://imagetwist.com/1v1tk5exo97v/cd_s1111_nikkibrooks_bootjerkoff.jpg)
https://img119.imagetwist.com/th/45054/wtkpmkuo63rc.jpg (https://imagetwist.com/wtkpmkuo63rc/RcCTmfDt.jpg)

Description:
Madame Nikki Brooks wants to see how well her slave bitch can worship her boots. Madame Nikki is pleased at his ability to follow her directions, and has her pathetic slave eagerly sucking, licking and slurping her boots until she notices he has got an erection without asking. She has him jerk his pathetic slut stick off on her boots before making him slurp up his filth.
Model:
Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1111_nikkibrooks_bootjerkoff.mp4
File Size : 312.73 MB
Resolution : 1280x720
Duration : 00:06:35

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f80d4ce86305d (https://tezfiles.com/file/f80d4ce86305d)

Tiered
01-17-2022, 03:34 PM
Clubdom.com- Goddess Cheyenne Jean Bardot Caning
https://img119.imagetwist.com/th/45055/7bcqxbo8b7f9.jpg (https://imagetwist.com/7bcqxbo8b7f9/cd_s1098_goddesscheyenne_mistressjeanbardot_caning .jpg)
https://img119.imagetwist.com/th/45056/h2t5zu5d3ax0.jpg (https://imagetwist.com/h2t5zu5d3ax0/uLLwlGut.jpg)

Description:
Goddess Cheyenne and Mistress Jean Bardot are training their new slave by caning his bare ass. They remind him how important it is to be appreciative of their attention and energy. Goddess Cheyenne and Mistress Jean Bardot take turns caning his pale ass and leave many bright red marks on it.
Model:
Goddess Cheyenne, Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s1098_goddesscheyenne_mistressjeanbardot_caning .mp4
File Size : 303.49 MB
Resolution : 1280x720
Duration : 00:06:26

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/8d57fda57d5cb (https://tezfiles.com/file/8d57fda57d5cb)

Tiered
01-17-2022, 03:41 PM
Clubdom.com- So you want to be a video slut?
https://img165.imagetwist.com/th/44654/77xzalqt57g6.jpg (https://imagetwist.com/77xzalqt57g6/cd_12_30_12_slutpov.jpg)
https://img165.imagetwist.com/th/44654/yn2c3lu96guk.jpg (https://imagetwist.com/yn2c3lu96guk/cd_12_30_12_slutpov.mp4.jpg)

Description:
Goddess Brianna knows what you crave - to be one of the video _ you see taking a Mistress_s huge strapon cock up his ass Well, she is going to tell you how to train like one, so be prepared for some painful ass training - some nipple torture - and to jerk off that pathetic little cock of yours. And yes, you will be eating your own cum as well. are you brave enough to live out your fantasies and abuse your own ass and cock like a Mistress would?
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : cd_12_30_12_slutpov.mp4
File Size : 42.79 MB
Resolution : 640x360
Duration : 00:05:28

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c8917715c7b3d (https://tezfiles.com/file/c8917715c7b3d)

Tiered
01-17-2022, 03:48 PM
Clubdom.com- Doormat for Queen
https://img202.imagetwist.com/th/45042/dpzlxpla12zo.jpg (https://imagetwist.com/dpzlxpla12zo/doormat_of_fur_queencd.jpg)
https://img202.imagetwist.com/th/45042/vcmotjscj76j.jpg (https://imagetwist.com/vcmotjscj76j/TPnZeH.jpg)

Description:
My slave has pissed me off and so I inform him that he does not get to attend the party tonight with me. Instead he will serve as my door mat. Dressed in my leopard print dress and gorgeous black fur coat, I make him clean the bottoms of my red pumps, and just for good measure, I make him deep throat the heels. I dig my heels into his nipples and kick him in the balls, letting him know his place beneath my feet. Then I remove one of my shoes and make him gag on my feet and worship my toes. This loser slave will learn not to piss me off.
Model:
Alina Long
Studio:
Clubdom.com
Info:
File Name : doormat_of_fur_queencd.wmv
File Size : 366.99 MB
Resolution : 1280x720
Duration : 00:06:14

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4ba2445779b66 (https://tezfiles.com/file/4ba2445779b66)

Tiered
01-17-2022, 03:53 PM
Clubdom.com- Daisy Ducati Raven Bay Small Dick
https://img119.imagetwist.com/th/44834/btrknb8sbn7v.jpg (https://imagetwist.com/btrknb8sbn7v/s809daistyducatiravenbaysmalldickpov.jpg)
https://img165.imagetwist.com/th/44834/q79omcw9ba68.jpg (https://imagetwist.com/q79omcw9ba68/wkcWFCqb.jpg)

Description:
Goddess Daisy Ducati and Raven Bay are giving you jerk off instruction today, First thing they want you to do is get a ruler, Then measure that tiny pathetic cock, What only 2 inches, Thats what we thought loser, now take some icy hot and rub it on that tiny excuse of a dick and keep rubbing it until it starts to burn, That_s right slut now that your little dicklet feels like it_s on fire we want you to smack those tiny little pebbles you like to call balls, take the ruler and beat those little suckers till they are bright red and start to swell, Then i am going to count to three and you better shoot your pathetic load
Model:
Daisy Ducati, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s809daistyducatiravenbaysmalldickpov.mp4
File Size : 374.64 MB
Resolution : 1280x720
Duration : 00:07:52

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e2c50f8acf128 (https://tezfiles.com/file/e2c50f8acf128)

Tiered
01-17-2022, 03:54 PM
Clubdom.com- Tiny Dick Defeated and Milked (Wrestling)
https://img119.imagetwist.com/th/44664/wclbdhvkt2g9.jpg (https://imagetwist.com/wclbdhvkt2g9/cd_04_20_13_wrestlingh.jpg)
https://img119.imagetwist.com/th/44664/9i9pm9rhg7xk.jpg (https://imagetwist.com/9i9pm9rhg7xk/cd_04_20_13_wrestlingh.mp4.jpg)

Description:
Alexis and Macy are working out on the mats when a jerk comes over and tells them to get off the mats. Alexis and Macy tower over the tiny jerk, then take him up on his offer to wrestle. His bragging is short lived as the women easily overpower him with a number of holds. While Alexis has him helpless, Macy pulls down his shots to show that the jerk even has a tiny dick as well
Model:
Alexis Grace, Macy Cartel
Studio:
Clubdom.com
Info:
File Name : cd_04_20_13_wrestlingh.mp4
File Size : 340.59 MB
Resolution : 1280x720
Duration : 00:07:13

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a04eff45b0926 (https://tezfiles.com/file/a04eff45b0926)

Tiered
01-17-2022, 03:56 PM
Clubdom.com- Fuck Your Way To Freedom
https://img119.imagetwist.com/th/45062/j6bckcdjn74c.jpg (https://imagetwist.com/j6bckcdjn74c/cd_s755_full_ravenbay_alinalong_pigfuck.jpg)
https://img202.imagetwist.com/th/45062/uqrdummwnfyd.jpg (https://imagetwist.com/uqrdummwnfyd/DZyUNhsD.jpg)

Description:
Goddess Raven bay and mistress Alina Long find a poor excuse of a man tied up in the woods to a tree all tattered and torn the ladies decide to have a little fun with this looser they offer to cut him down but inform him that he will have to fuck his way to freedom by doing everything they tell him Goddess Raven hands him a blow up lamb and makes him fuck it and onk like the man pig he is completely humiliating him and making him lick his own filth up just to amuse them, and this is just the start of his day. Goddess Raven bay and Mistress Alina Long now have their new found slave back at the clubdom estate and tell him maybe he can lick his way to freedom by worshiping their thigh high shiny black boots, That_s right bitch you heard us start licking our filthy boots, Worshiping the ground beneath our feet licking our filthy dirty boots that_s right suck=ck the heel like its a big black cock swallow it up, deep throat it and maybe we will set you free, the ladies start to laugh at this eager boot slut, Goddess Raven Bay spreads her wet pink pussy and lets him get a look and then rubs it as she starts moaning and asks if he would like some ? yes, he replies and they both laugh, your not worthy slut back to the heel of my boots keep licking your way to freedom. Goddess Alina Long and Raven Bay are still having fun with their new pathetic slave boy the one they found tied to a tree, they made him fuck his way tp freedom by having him fuck a blow-up sheep Then they made him worship their boots and teased him with their pussy_s letting him breathe in their essence but never touching, so now they have decided to go for a pony cart ride and make this poor slave pull them all around the estate and Goddess raven hand the out of breath bitch a teaspoon, and tells him it_s time for his nourishment so he better start stroking that tiny little slut stick and fill the teaspoon up with his filth and then he will eat up every last drop
Model:
Alina Long, Raven Bay
Studio:
Clubdom.com
Info:
File Name : cd_s755_full_ravenbay_alinalong_pigfuck.mp4
File Size : 836.08 MB
Resolution : 1280x720
Duration : 00:17:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f3bb762eaf109 (https://tezfiles.com/file/f3bb762eaf109)

Tiered
01-17-2022, 04:05 PM
Clubdom.com- Cry for Madame Nikki
https://img202.imagetwist.com/th/45053/pmwoya9l92ls.jpg (https://imagetwist.com/pmwoya9l92ls/cd_s1075_nikkibrooks_whippin.jpg)
https://img202.imagetwist.com/th/45053/d89azqnn1osu.jpg (https://imagetwist.com/d89azqnn1osu/PzrdgqN.jpg)

Description:
Goddess Nikki Brooks wants to whip her pathetic skinny slave. She rakes his back with her nails so that his back is primed to feel the sting of her red whip. Goddess Nikki_s slave dances in place as she mercilessly leaves deep red marks on his white flesh.
Model:
Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1075_nikkibrooks_whippin.mp4
File Size : 428.56 MB
Resolution : 1280x720
Duration : 00:09:06

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/968330ae226ac (https://tezfiles.com/file/968330ae226ac)

Tiered
01-17-2022, 04:14 PM
Clubdom.com- Amusing balls
https://img119.imagetwist.com/th/45176/6fl1g7y8deky.jpg (https://imagetwist.com/6fl1g7y8deky/movie220.jpg)
https://img119.imagetwist.com/th/45176/j6x02qvmt6rg.jpg (https://imagetwist.com/j6x02qvmt6rg/mBnBbEK.jpg)

Description:
Lady Cheyenne has her slut in a ball vice with his hands restrained over his head. She takes a leather crop to the slut_s cock and a cane to his balls. Cheyenne means business. She wants to the destroy the bitch_s manhood. When the slut begins to wince and moan, Cheyenne turns the heat up even more, You should be glad these balls amuse me. Cheyenne continues to torment the slut_s cock and balls. Why do you think I let you keep these? Cheyenne says as she canes the bitch_s nuts. Men should be grateful that women find their ball amusing
Model:
Ball Busting, Caning, CBT, Whipping
Studio:
Clubdom.com
Info:
File Name : Movie220.wmv
File Size : 184.58 MB
Resolution : 720x480 @ 810x480
Duration : 00:08:06

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/cf4f696313cb0 (https://tezfiles.com/file/cf4f696313cb0)

Tiered
01-17-2022, 04:15 PM
Clubdom.com- Goddesse_s Boot Bitch Complies
https://img69.imagetwist.com/th/44821/336lrs6u37xx.jpg (https://imagetwist.com/336lrs6u37xx/s516_deanna_winters_boot_lick_jerk_off.jpg)
https://img165.imagetwist.com/th/44821/rfo3mssq88hp.jpg (https://imagetwist.com/rfo3mssq88hp/HfMbDH.jpg)

Description:
Deanna Winters is fully in charge of her boot bitch. She has the slut rigged up with an electronic collar around his balls and is wearing her stunning thigh high boots. Ms. Winters knows she has full control over this slut as she orders him to worship her boots, from the tippy top to sucking the sharp heel. Merely for her own pleasure, Deanna gives the slut a good shock in his pathetic balls as she instructs the slut to properly worship her boots. Finally, she allows the slut to release his male filth on her boots, knowing the bitch will soon be ordered to lick up every bit of his own filth. Deanna delights in shocking the slut_s balls as he rushes to clean up the mess he left on her boots.
Model:
Deanna Winters
Studio:
Clubdom.com
Info:
File Name : s516_deanna_winters_boot_lick_jerk_off.mp4
File Size : 279.37 MB
Resolution : 1280x720
Duration : 00:05:52

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/27ed74bf5e7eb (https://tezfiles.com/file/27ed74bf5e7eb)

Tiered
01-17-2022, 04:26 PM
Clubdom.com- Straitjacket Slaves Monthly Milking
https://img202.imagetwist.com/th/44823/29r5u5v3jmfu.jpg (https://imagetwist.com/29r5u5v3jmfu/s591marinaangelmilkingslut.jpg)
https://img202.imagetwist.com/th/44823/w1wcs4gjlrpu.jpg (https://imagetwist.com/w1wcs4gjlrpu/tEUwOa.jpg)

Description:
There is no better way to prevent unauthorized dick touching than with a straitjacket. New ClubDom resident slave Jerk off boy had to be restrained and Mistress Molly Jane and Goddess Marina Angel decide its time for this bitches monthly feeding. They enter the dungeon looking fierce in their thigh high glossy black boots. Jerk off boy shakes with excitement like a pathetic little monkey. The ladies laugh and ask are you ready for your milking? They start stroking his slut stick. First soft and slow then fast edging the bitch, driving him crazy until finally he blows a huge load of white thick disgusting man filth into Marinas hand. They feed the cum slut every drop. The ladies laugh as they walk off see you in 30 days cum guzzler.
Model:
Marina Angel, Molly Jane
Studio:
Clubdom.com
Info:
File Name : s591marinaangelmilkingslut.mp4
File Size : 315.79 MB
Resolution : 1280x720
Duration : 00:06:41

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/bc196cba46f34 (https://tezfiles.com/file/bc196cba46f34)

Tiered
01-17-2022, 04:30 PM
Clubdom.com- How To Slap a Bitch
https://img165.imagetwist.com/th/44663/z230oacrw10e.jpg (https://imagetwist.com/z230oacrw10e/cd_03_10_13_faceslapping.jpg)
https://img119.imagetwist.com/th/44663/bplx6iiai44m.jpg (https://imagetwist.com/bplx6iiai44m/cd_03_10_13_faceslapping.mp4.jpg)

Description:
Mistress Vendetta shows Mistress Charli a simple way to keep slaves in line when they misbehave - slap the bitch in the face. Vendetta slaps her bitch with no mercy, rocking his face again and again. She slaps him so hard that he even falls to the ground from the slap - all for Vendetta_s amusement. It does not matter that he has done nothing wrong he is just a toy for his Mistresses to use.
Model:
Face Slapping
Studio:
Clubdom.com
Info:
File Name : cd_03_10_13_faceslapping.mp4
File Size : 358.5 MB
Resolution : 1280x720
Duration : 00:07:36

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/cb5826538c69e (https://tezfiles.com/file/cb5826538c69e)

Tiered
01-17-2022, 04:47 PM
Clubdom.com- Cum on Her Boots, Slut
https://img119.imagetwist.com/th/44722/8x02g6dtihtc.jpg (https://imagetwist.com/8x02g6dtihtc/jessicaraynkendracdbootlick.jpg)
https://img119.imagetwist.com/th/44722/yrupnwrnp03t.jpg (https://imagetwist.com/yrupnwrnp03t/jessicaraynkendracdbootlick.mp4.jpg)

Description:
Kendra James and Jessica Raynes own their slut with their boots. They demand the slut worship their shiny black boots and suck their heels until they are perfectly clean. The boot slut is informed that from now on the only release he will have is when at their boots. Kendra demands that the slut spill his male filth on her boots and then lick every drop up
Model:
Jessica Rayne, Kendra James
Studio:
Clubdom.com
Info:
File Name : jessicaraynkendracdbootlick.mp4
File Size : 238.77 MB
Resolution : 1280x720
Duration : 00:07:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/911507a1fcb8f (https://tezfiles.com/file/911507a1fcb8f)

Tiered
01-17-2022, 04:47 PM
Clubdom.com- Hope Harper Marsha May POV
https://img202.imagetwist.com/th/44828/0396ak980bie.jpg (https://imagetwist.com/0396ak980bie/s718hopeharpermarshamaypov.jpg)
https://img202.imagetwist.com/th/44828/gxwxf1yd25xp.jpg (https://imagetwist.com/gxwxf1yd25xp/GcuPHx.jpg)

Description:
Bratty Doms Marsha May and Hope Harper know how pathetic you are and just how bad you want to spill your looser goo, the ladies tease and torment you with their sexy bodies as the lift up their little red school girl skirts and laugh as you stroke that tiny little dickett. The girls count you down from ten and make you lick up all your disgusting man filth.
Model:
Hope Harper, Marsha May
Studio:
Clubdom.com
Info:
File Name : s718hopeharpermarshamaypov.mp4
File Size : 231.54 MB
Resolution : 1280x720
Duration : 00:04:57

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4e205d4634c1a (https://tezfiles.com/file/4e205d4634c1a)

Tiered
01-17-2022, 04:56 PM
Clubdom.com- Mistress Raven Eve Demands Worship
https://img119.imagetwist.com/th/45080/xpwy5n0wgzpn.jpg (https://imagetwist.com/xpwy5n0wgzpn/cd_s1288_alissaavni_raveneve_bootworship.jpg)
https://img202.imagetwist.com/th/45080/avw096dpx7hs.jpg (https://imagetwist.com/avw096dpx7hs/BNOqrEd.jpg)

Description:
Mistress Raven Eve demands worship and she desires that in the form of boot worship. Her slave isn_t worthy of licking anything else. He must lick her boots as she instructs, shining them, licking any dirt off of them with his mouth just as a slave should. Should the slave not please her, he is really going to be in trouble. He makes sure to do a very good job.
Model:
Raven Eve
Studio:
Clubdom.com
Info:
File Name : cd_s1288_alissaavni_raveneve_bootworship.mp4
File Size : 349.43 MB
Resolution : 1280x720
Duration : 00:07:24

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/eb1f4c34a2e15 (https://tezfiles.com/file/eb1f4c34a2e15)

Tiered
01-17-2022, 05:02 PM
Clubdom.com- Crushed Punched and Caned
https://img119.imagetwist.com/th/45182/z2zklb5pqivc.jpg (https://imagetwist.com/z2zklb5pqivc/movie70cfs.jpg)
https://img119.imagetwist.com/th/45182/pyxcmxf8pa35.jpg (https://imagetwist.com/pyxcmxf8pa35/bumXnpTV.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie70cfs.mp4
File Size : 47.53 MB
Resolution : 640x480
Duration : 00:04:03

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/dafd19381b19e (https://tezfiles.com/file/dafd19381b19e)

Tiered
01-17-2022, 05:03 PM
Clubdom.com- Breaking Cane 700 Strokes
https://img202.imagetwist.com/th/45066/26bpx6a0yv20.jpg (https://imagetwist.com/26bpx6a0yv20/cd_s672_dava_kylie_breakingcane.jpg)
https://img119.imagetwist.com/th/45066/xg7p3xsw25od.jpg (https://imagetwist.com/xg7p3xsw25od/tqxEPJN.jpg)

Description:
Goddess Kylie Rogue and Mistress Dava drag the strait jacket slave bitch into the Dungeon. They decide it_s time to cane this slave_s ass hard until it looks like raw hamburger meat. Goddess Kylie breaks her cane on his ass and tells the bitch he_s getting 700 strokes and after that she will shove the broken cane up his slutty asshole. The ladies are ruthless and sadistic showing him no mercy. They take turns brutally caning his ass as he screams out begging for mercy. Mistress Dava informs him that there is never any mercy at ClubDom and continues to cane him unmercifully.After they have finished caning him Goddess Kylie shoves the broken cane right up his ass.
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : cd_s672_dava_kylie_breakingcane.mp4
File Size : 333.83 MB
Resolution : 1280x720
Duration : 00:07:05

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/fc5644a08810c (https://tezfiles.com/file/fc5644a08810c)

Tiered
01-17-2022, 05:06 PM
Clubdom.com- Caning and Chindo Fucking Video
https://img202.imagetwist.com/th/44741/avkcgfq2vaf4.jpg (https://imagetwist.com/avkcgfq2vaf4/s437_caning_chindo.jpg)
https://img33.imagetwist.com/th/44741/p1jjhf1vmlaj.jpg (https://imagetwist.com/p1jjhf1vmlaj/s437_caning_chindo.mp4.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Raven Bay
Studio:
Clubdom.com
Info:
File Name : s437_caning_chindo.mp4
File Size : 315.4 MB
Resolution : 1280x720
Duration : 00:06:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/8586a2e5fcd4d (https://tezfiles.com/file/8586a2e5fcd4d)

Tiered
01-17-2022, 05:12 PM
Clubdom.com- Incompetent Ashtray
https://img119.imagetwist.com/th/44660/a3mlzp7pth3c.jpg (https://imagetwist.com/a3mlzp7pth3c/cd_03_09_13_smoking.jpg)
https://img33.imagetwist.com/th/44660/5dqqfqpdcbsd.jpg (https://imagetwist.com/5dqqfqpdcbsd/cd_03_09_13_smoking.mp4.jpg)

Description:
Goddess Amadahy and Mistress Vendetta have been training their slave as a domestic servant but have grown tired of his incompetence. When they call for him and he forgets a lighter and an ashtray for them, they decide that he will be used as their ashtray.

Amadahy and Vendetta fill the slave_s mouth with ash as they enjoy their wine, making sure to let their spit drool onto the slave_s face as a reminder of his lowly position. By the time the Mistresses put their cigarettes out on his tongue, his face is covered in ash and drool. The Mistresses just laugh as they order their bitch to swallow everything in his mouth.
Model:
Goddess Amadahy, Vendetta
Studio:
Clubdom.com
Info:
File Name : cd_03_09_13_smoking.mp4
File Size : 308.25 MB
Resolution : 1280x720
Duration : 00:06:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1fb99128c78a5 (https://tezfiles.com/file/1fb99128c78a5)

Tiered
01-17-2022, 05:14 PM
Clubdom.com- Elbows Knees and Feet
https://img119.imagetwist.com/th/45182/mzmilvc5sa7d.jpg (https://imagetwist.com/mzmilvc5sa7d/movie71cfs.jpg)
https://img119.imagetwist.com/th/45182/k1aojz50dn4v.jpg (https://imagetwist.com/k1aojz50dn4v/YeAUbCGq.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie71cfs.mp4
File Size : 49.81 MB
Resolution : 640x480
Duration : 00:04:14

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e40ece0b58530 (https://tezfiles.com/file/e40ece0b58530)

Tiered
01-17-2022, 05:21 PM
Clubdom.com- Tormenting The Slave Part 1
https://img119.imagetwist.com/th/44715/1hti20gh1lah.jpg (https://imagetwist.com/1hti20gh1lah/tormentingtheslavepart1.jpg)
https://img119.imagetwist.com/th/44715/ty3c81h5cbg1.jpg (https://imagetwist.com/ty3c81h5cbg1/tormentingtheslavepart1.mp4.jpg)

Description:
Goddess Amadahy and Mistress Mia have there slave locked in a kennel. He has been locked in for days. The Mistress_s torment the slave by telling him what all the cruel things they plan for him. Goddess Amadahy smokes her cigarette and ashes it on to him. The Mistress_s go over what they could do with this loser so they let him out. Goddess Amadahy pulls out a cattle prod and begins to shock the slave. Goddess Amadahy wants to see how fast and how much pain the slave can take.
Model:
Goddess Amadahy, Mistress Mia
Studio:
Clubdom.com
Info:
File Name : tormentingtheslavepart1.mp4
File Size : 147.89 MB
Resolution : 640x360
Duration : 00:06:36

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/433cbe6af951e (https://tezfiles.com/file/433cbe6af951e)

Tiered
01-17-2022, 05:35 PM
Clubdom.com- Pounding the Nuts
https://img202.imagetwist.com/th/45171/oy7d93wb05tb.jpg (https://imagetwist.com/oy7d93wb05tb/movie296cfs.jpg)
https://img119.imagetwist.com/th/45171/h9bbv2zpbhao.jpg (https://imagetwist.com/h9bbv2zpbhao/LTTIdBiH.jpg)

Description:
Cheyenne has her slave restrained on a bondage rack. She lays into his balls with several dead on kicks. Then she releases him and demand that he stand and present his balls to her. The slave complies. Cheyenne nails him in the balls with more brute force kicks. The slave falls to the ground. Cheyenne pounces on him and begins punching and kneeing his already aching balls.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie296cfs.mp4
File Size : 29.73 MB
Resolution : 640x480
Duration : 00:02:35

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4b1e1df8c119f (https://tezfiles.com/file/4b1e1df8c119f)

Tiered
01-17-2022, 05:36 PM
Clubdom.com- Veronica Kylie Rogue CBT POV
https://img202.imagetwist.com/th/44835/fedonu1z3bnw.jpg (https://imagetwist.com/fedonu1z3bnw/s838veronicacohenkylieroguecbtpov.jpg)
https://img165.imagetwist.com/th/44835/ddbyqxcxwunz.jpg (https://imagetwist.com/ddbyqxcxwunz/xXwayxb.jpg)

Description:
You are going to have to earn the permission to spill your filth today Mistress Veronica Cohen wants you to stick your balls out for a proper cbt instruction. Mistress Kylie Rogue demonstrates how fast each blow should be on those filth sacks.They know your slutty hand is ready to reach for that dicklet but you haven_t impressed Veronica yet, so you will be punishing those balls more. you_re such a pain-slut that you are about to spill already, your Mistresses will count you down though, so don_t dare spill a drop earlyv
Model:
Kylie Rogue, Veronica Cohen
Studio:
Clubdom.com
Info:
File Name : s838veronicacohenkylieroguecbtpov.mp4
File Size : 278.84 MB
Resolution : 1280x720
Duration : 00:05:56

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2dad9aa8f3dd0 (https://tezfiles.com/file/2dad9aa8f3dd0)

Tiered
01-17-2022, 05:38 PM
Clubdom.com- Ruined Orgasm Milking
https://img33.imagetwist.com/th/44666/9h0lihyoxkz3.jpg (https://imagetwist.com/9h0lihyoxkz3/cd_05_04_13_milking.jpg)
https://img119.imagetwist.com/th/44666/0jjftrlocr4c.jpg (https://imagetwist.com/0jjftrlocr4c/cd_05_04_13_milking.mp4.jpg)

Description:
After weeks of being denied an orgasm, it is this slave_s lucky day - or so he thinks. With the beautiful Mistress Elena Sin milking his cock while the sexy Goddess Amadahy is sitting on his face, grinding her gorgeous ass and pussy into his face, who could blame him?

Elena masterfully milks the slave_s cock until he is begging the Mistresses to cum. They grant him permission, but Elena harshly starts pulling his cock and balls right as he is cumming, ruining any pleasure the slave might have gotten from the orgasm. The Mistresses just laugh as the slave cries in agony over his abused cock and balls.
Model:
Elena Sin, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_05_04_13_milking.mp4
File Size : 61.84 MB
Resolution : 640x360
Duration : 00:06:25

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a290179defb82 (https://tezfiles.com/file/a290179defb82)

Tiered
01-17-2022, 05:39 PM
Clubdom.com- Lydia Supervises Your SissyClitty_s Milking
https://img69.imagetwist.com/th/44835/tiegg7a9l00k.jpg (https://imagetwist.com/tiegg7a9l00k/s843lydiasupremacykylieroguepov.jpg)
https://img165.imagetwist.com/th/44835/maubit51ivyf.jpg (https://imagetwist.com/maubit51ivyf/BLUSLMnC.jpg)

Description:
Lydia Supremacy wants to see you really get into it, use your fingers and stroke that small cock. Kylie rogue teases and taunts you but tells you that you are only to spill any filth at all at the very end of their instructions. Lydia is feeling generous today so she even spits on your slut hole for you to fuck it hard while they count you down to spilling.
Model:
Kylie Rogue, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : s843lydiasupremacykylieroguepov.mp4
File Size : 269.97 MB
Resolution : 1280x720
Duration : 00:05:51

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/cee4c217921f5 (https://tezfiles.com/file/cee4c217921f5)

Tiered
01-17-2022, 05:49 PM
Clubdom.com- Whipping Initiation
https://img119.imagetwist.com/th/45168/1iaxr1mg1hdk.jpg (https://imagetwist.com/1iaxr1mg1hdk/movie450cfs.jpg)
https://img119.imagetwist.com/th/45168/gnn1bik2bod1.jpg (https://imagetwist.com/gnn1bik2bod1/eVRTvAYn.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Whipping
Studio:
Clubdom.com
Info:
File Name : movie450cfs.mp4
File Size : 79.14 MB
Resolution : 640x480
Duration : 00:06:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a8cdf1ea28502 (https://tezfiles.com/file/a8cdf1ea28502)

Tiered
01-17-2022, 05:50 PM
Clubdom.com- Michelle Controls You
https://img33.imagetwist.com/th/45061/t85wfgh40t9i.jpg (https://imagetwist.com/t85wfgh40t9i/cd_s1128_michellelacy_pov2.jpg)
https://img33.imagetwist.com/th/45061/ir477ed29djx.jpg (https://imagetwist.com/ir477ed29djx/KcSngBq.jpg)

Description:
Goddess Michelle Lacy knows you love it when she strokes her cock for you. She is standing in front of you telling you what she is going to do to you with her massive black cock.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1128_michellelacy_pov2.mp4
File Size : 213.4 MB
Resolution : 1280x720
Duration : 00:04:33

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a9a4d04c1e5e9 (https://tezfiles.com/file/a9a4d04c1e5e9)

Tiered
01-17-2022, 06:03 PM
Clubdom.com- Lesbian Cuckolding Part 2
https://img202.imagetwist.com/th/44657/n0fm6e2qdqoy.jpg (https://imagetwist.com/n0fm6e2qdqoy/cd_02_05_13_doubledildo.jpg)
https://img33.imagetwist.com/th/44657/nua0zzsm78hk.jpg (https://imagetwist.com/nua0zzsm78hk/cd_02_05_13_doubledildo.mp4.jpg)

Description:
The beautiful Mistresses Kendra and Elena enjoy each others bodies, making out and kissing while their hapless cuckold slave kneels on their leash. Arms bound and cock locked, the slave can only look on as his Mistresses enjoy fucking each other with a double sided dildo, as they have no use at all for pathetic slave cock - except to chastise and humiliate it.
Model:
Elena Sin, Kendra James
Studio:
Clubdom.com
Info:
File Name : cd_02_05_13_doubledildo.mp4
File Size : 62.53 MB
Resolution : 640x360
Duration : 00:07:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/7937e39336c2c (https://tezfiles.com/file/7937e39336c2c)

Tiered
01-17-2022, 06:05 PM
Clubdom.com- Finger Your Man Pussy and Jerk
https://img119.imagetwist.com/th/44823/px2a6dsuh9d2.jpg (https://imagetwist.com/px2a6dsuh9d2/s568_jean_bardot_kylie_rogue_pov.jpg)
https://img69.imagetwist.com/th/44823/a6zj3e27qsmz.jpg (https://imagetwist.com/a6zj3e27qsmz/SAPNBJoh.jpg)

Description:
Mistress Kylie Rogue and Goddess Jean Bardot teases you with their boots and Kylies wet pussy until your dick is rock hard. I bet you want to cum for me. Kylie says coyly. Then she instructs you to get your dick even harder. She spreads her legs and lets you get a glimpse of her beautiful pink pussy . Do you like my pussy? She asks. If you want to jerk off to my wet pussy, I want you to finger fuck your man pussy. Goddess Jean is ruthless as she brings you right to the edge teasing you with Kylie_s warm wet pussy. They refuse to let you cum until you finger your asshole. The only way the Mistress_s will allow you to orgasm is while you are finger fucking your man pussy. Mistress Kylie takes great delight watching you finger your ass. You can add another finger in that tight ass. Jean says. Finally they let you get off. After you have exploded, the ladies smile, Now clean up your mess.
Model:
Jean Bardot, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s568_jean_bardot_kylie_rogue_pov.mp4
File Size : 281.5 MB
Resolution : 1280x720
Duration : 00:05:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a04a238343882 (https://tezfiles.com/file/a04a238343882)

Tiered
01-17-2022, 06:05 PM
Clubdom.com- Admit it You_re Gay
https://img202.imagetwist.com/th/45069/q3wfpy000v36.jpg (https://imagetwist.com/q3wfpy000v36/cd_s675_dava_kylie_pov.jpg)
https://img202.imagetwist.com/th/45069/lrlu5mqodl4u.jpg (https://imagetwist.com/lrlu5mqodl4u/wCPXbRm.jpg)

Description:
Goddess Kylie Rogue and Mistress Dava Foxx know you_re sitting there staring at their huge black strap-on cocks wishing that both 12_ rods were shoved up your slutty ass at the same time. You are a Cock whore Just admit it, you dream of huge hard cock in your mouth and then dream of being bent over and fucked in your man cunt like the bitch that you are. Stroking that little pathetic excuse you have for a cock. You will never be able please any woman. It_s only good for you to stroke with your thumb and index finger while you dream of Dom cock shoved up your ass. You spill your tiny load of filth just hoping for permission to eat it. You slut
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : cd_s675_dava_kylie_pov.mp4
File Size : 310.71 MB
Resolution : 1280x720
Duration : 00:06:33

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/307c14ff33c49 (https://tezfiles.com/file/307c14ff33c49)

Tiered
01-17-2022, 06:09 PM
Clubdom.com- Inga Victoria: Pussy For Dinner Part 3
https://img119.imagetwist.com/th/45045/i6v938reijoz.jpg (https://imagetwist.com/i6v938reijoz/s9473-3ingavictoriabg.jpg)
https://img202.imagetwist.com/th/45045/wc6hlaoesp85.jpg (https://imagetwist.com/wc6hlaoesp85/jvLTFPqN.jpg)

Description:
Inga Victoria has been using this slave for her pleasure despite him being starving and worked hard at her house for 3 days doing yard work He now must work very hard...fucking her until she is good and satisfied. Normally she keeps him in chastity but she hasn_t lately as he is now afraid to even get a hard-on unless she commands it. Now he has full permission to be inside of her. Such a thrill fucking such a powerful woman and feeling her body. After she is done, she commands him to cum on her tits....and lick it ALL off. A moment later, She is eating a very large plate of food, but she will not share. He had his chance earlier and he had chose her pussy over food. Now he gets nothing but his own filth.
Model:
Inga Victoria
Studio:
Clubdom.com
Info:
File Name : s9473-3ingavictoriabg.mp4
File Size : 622.65 MB
Resolution : 1280x720
Duration : 00:11:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0493327efb111 (https://tezfiles.com/file/0493327efb111)

Tiered
01-17-2022, 06:12 PM
Clubdom.com- Drink Your Protein Shake
https://img165.imagetwist.com/th/44666/hwo27d3pwz0k.jpg (https://imagetwist.com/hwo27d3pwz0k/cd_05_18_13_milking.jpg)
https://img33.imagetwist.com/th/44666/vpoeezj42vdn.jpg (https://imagetwist.com/vpoeezj42vdn/cd_05_18_13_milking.mp4.jpg)

Description:
Mistresess Esmi and Amanda have their milking slave bound and ready. Esmi laughs at their bitch, telling him that it is time for his feeding he is going to get a protein shake, but to Esmi, that means the cum that she is going to shake out of his cock

Esmi and Amanda expertly milk the slave_s cock, getting him more and more horny until he shoots his load. Esmi then makes sure he eats all of his protein shake as the Mistresses laugh at the pathetic bitch. Maybe in a few weeks they might let him eat again.
Model:
Amanda Tate, Esmi Lee
Studio:
Clubdom.com
Info:
File Name : cd_05_18_13_milking.mp4
File Size : 315.92 MB
Resolution : 1280x720
Duration : 00:06:40

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/7fb3f18f82e2d (https://tezfiles.com/file/7fb3f18f82e2d)

Tiered
01-17-2022, 06:15 PM
Clubdom.com- Edging Masturbation Instruction POV
https://img33.imagetwist.com/th/44741/6o27j9gbsl1e.jpg (https://imagetwist.com/6o27j9gbsl1e/s431_edging_pov.jpg)
https://img69.imagetwist.com/th/44741/30x0n563otoc.jpg (https://imagetwist.com/30x0n563otoc/s431_edging_pov.mp4.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : s431_edging_pov.mp4
File Size : 287.51 MB
Resolution : 1280x720
Duration : 00:06:07

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/8cb34676f78b5 (https://tezfiles.com/file/8cb34676f78b5)

Tiered
01-17-2022, 06:16 PM
Clubdom.com- Eating Your Filth with 3 Mistresses
https://img69.imagetwist.com/th/44745/3dfgp6lp28wg.jpg (https://imagetwist.com/3dfgp6lp28wg/s472_hj_eating_your_filth_vanessa_alexa_riley.jpg)
https://img69.imagetwist.com/th/44745/h8d8o109t4wg.jpg (https://imagetwist.com/h8d8o109t4wg/s472_hj_eating_your_filth_vanessa_alexa_riley.mp4. jpg)

Description:
Watch as three mistresses milk a filthy useless guy.
Model:
Alexa Rydell, Riley Reynolds, Vanessa Cage
Studio:
Clubdom.com
Info:
File Name : s472_hj_eating_your_filth_vanessa_alexa_riley.mp4
File Size : 270.94 MB
Resolution : 1280x720
Duration : 00:05:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/66ea0dfa86321 (https://tezfiles.com/file/66ea0dfa86321)

Tiered
01-17-2022, 06:25 PM
Clubdom.com- Canning By The Moonlight
https://img119.imagetwist.com/th/44718/x277b0jopq22.jpg (https://imagetwist.com/x277b0jopq22/caningbythemoonlight.jpg)
https://img202.imagetwist.com/th/44718/9n3315n9lu7j.jpg (https://imagetwist.com/9n3315n9lu7j/caningbythemoonlight.mp4.jpg)

Description:
Mistress Alexis and Mistress Kendra spend the wee hours left in the day by brutally canning this pathetic slaves bare till nightfall. The Mistress_s verbally humiliate the slave as they cause pain and destruction to his bare bottom. The Mistress hit him so hard with there cane_s welts form immediately. The Mistress take great pleasure destroying their slaves ass and chuckle after every painful blow.
Model:
Alexis Grace, Kendra James
Studio:
Clubdom.com
Info:
File Name : caningbythemoonlight.mp4
File Size : 238.92 MB
Resolution : 640x360
Duration : 00:07:52

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/141a2c7573def (https://tezfiles.com/file/141a2c7573def)

Tiered
01-17-2022, 06:30 PM
Clubdom.com- Women Like Whipping Men
https://img119.imagetwist.com/th/45182/a5ph43ydwe9m.jpg (https://imagetwist.com/a5ph43ydwe9m/movie114cfs.jpg)
https://img119.imagetwist.com/th/45182/mvwb64qrzld2.jpg (https://imagetwist.com/mvwb64qrzld2/WlASbKkW.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie114cfs.mp4
File Size : 36.02 MB
Resolution : 640x480
Duration : 00:03:02

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/3c44f17f812e9 (https://tezfiles.com/file/3c44f17f812e9)

Tiered
01-17-2022, 06:31 PM
Clubdom.com- Michelle Tangent: Caning Coach Jackson
https://img119.imagetwist.com/th/45046/2rnl21uv97t3.jpg (https://imagetwist.com/2rnl21uv97t3/s941michelletangentrikkirumorcaningbart.jpg)
https://img119.imagetwist.com/th/45046/te0j6x2yq6tn.jpg (https://imagetwist.com/te0j6x2yq6tn/lhGPrTF.jpg)

Description:
Coach Jackson has been spying on poor Miss Mathews and makes very rude comments to her. She tells her teacher and principal on him. Professor Michelle and Principal Tangent decide to make the coach regret his ways and they call him into their office. He denies being a jerk to Miss Mathews, but they can see right through him, after all, they deal with men like him from time to time and this is why their school is so well-run, because they discipline all of the men employees themselves. spank and paddle him. The clip begins when they decide to really destroy him, with their canes. The three women, yes even Ricky, take turns putting the coach in his place, punishing him thoroughly with their hard firm canes.
Model:
Goddess Tangent, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s941michelletangentrikkirumorcaningbart.mp4
File Size : 387.34 MB
Resolution : 1280x720
Duration : 00:07:09

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f64f38926c5b0 (https://tezfiles.com/file/f64f38926c5b0)

Tiered
01-17-2022, 06:34 PM
Clubdom.com- Slaves Ruthless Slapping
https://img119.imagetwist.com/th/44714/ois51izfwr6z.jpg (https://imagetwist.com/ois51izfwr6z/slavesruthlessslapping.jpg)
https://img202.imagetwist.com/th/44714/w7w6vc1vatuo.jpg (https://imagetwist.com/w7w6vc1vatuo/slavesruthlessslapping.mp4.jpg)

Description:
Mistress Michelle is done with her slave he has pleased her enough. Mistress Michelle_s slave asks permission to speak. Mistress Michelle grants him permission to speak. The slave gets ballsy and ask his Mistress if he may release. Mistress Michell is furious and cant believe her slave think hes worthy of cumming. Mistress Michell quickly slaps his pathetic face then slaps some more. Mistress Michelle slaps his face over and over and scolds him for asking suck a daring question. Mistress even grabs the slaves balls and gives them a good slapping. Mistress Michelle beats the worthless slaves face ruthlessly then forces him back into his cage.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : slavesruthlessslapping.mp4
File Size : 116.3 MB
Resolution : 640x360
Duration : 00:05:11

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c27c44d024e94 (https://tezfiles.com/file/c27c44d024e94)

Tiered
01-17-2022, 06:38 PM
Clubdom.com- Jamie Valentine: Suffer to Cum
https://img119.imagetwist.com/th/45049/f9ca83cgejz8.jpg (https://imagetwist.com/f9ca83cgejz8/cd_s984_jamievalentine_handjob.jpg)
https://img202.imagetwist.com/th/45049/bfb7140iaxd8.jpg (https://imagetwist.com/bfb7140iaxd8/gGfYXAS.jpg)

Description:
Jamie Valentine has her slave all strung up and waiting for her. Today is the day he gets his slut-sack milked but not without him suffering greatly for it first. Jamie wants to make sure his balls are very sore when she finally squeezes that las drop of man filth out of his body. Jamie strokes him but stops to kick him in the nuts while laughing at how much pain he is in. She goes back and forth between giving him pleasure and such awful pain. If he is going to cum, she is going to tease, hurt and torment him for her entertainment in order for him to be able to do it. She is not here for his pleasure, he exists for hers.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cd_s984_jamievalentine_handjob.mp4
File Size : 362.24 MB
Resolution : 1280x720
Duration : 00:07:41

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/563eb927fcb4b (https://tezfiles.com/file/563eb927fcb4b)

Tiered
01-17-2022, 06:39 PM
Clubdom.com- Nikki Trains Your Sissy Slut-hole POV
https://img119.imagetwist.com/th/45053/66cfnb86ei0j.jpg (https://imagetwist.com/66cfnb86ei0j/cd_s1073_nikkibrooks_pov.jpg)
https://img119.imagetwist.com/th/45053/yllmmlv01gca.jpg (https://imagetwist.com/yllmmlv01gca/vSomgHXq.jpg)

Description:
Goddess Nikki Brooks is amused that you took it upon yourself to start masturbating. She stands over you forcing you to watch her stroke her thick black cock. Goddess Nikki gives you instructions on how to stroke your pathetic slut stick and tells you what she is going to do to your tight man pussy if you don_t obey her.
Model:
Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1073_nikkibrooks_pov.mp4
File Size : 398.78 MB
Resolution : 1280x720
Duration : 00:08:25

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1033d203a49b0 (https://tezfiles.com/file/1033d203a49b0)

Tiered
01-17-2022, 06:45 PM
Clubdom.com- Tiny Dick Defeated and Milked (Handjobs)
https://img202.imagetwist.com/th/44665/bcn091xt2hl3.jpg (https://imagetwist.com/bcn091xt2hl3/cd_04_20_13_handjob.jpg)
https://img119.imagetwist.com/th/44665/6hyn610ko3k8.jpg (https://imagetwist.com/6hyn610ko3k8/cd_04_20_13_handjob.mp4.jpg)

Description:
Alexis and Macy can not help but make fun of the tiny penis on jerk they just defeated on the mat, so they decide to jerk it just for their amusement. Of course, they only need a couple of fingers because it is so small When the tiny dicked jerk actually manages to cum from the milking, Macy and Alexis makes sure he eats every drop of the cum dribbled from his tiny little cock.
Model:
Alexis Grace, Macy Cartel
Studio:
Clubdom.com
Info:
File Name : cd_04_20_13_handjob.mp4
File Size : 72.24 MB
Resolution : 640x360
Duration : 00:07:36

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/45ccedea0d2c4 (https://tezfiles.com/file/45ccedea0d2c4)

Tiered
01-17-2022, 06:47 PM
Clubdom.com- Punished with BallBusting
https://img202.imagetwist.com/th/45051/4igpnigee3s2.jpg (https://imagetwist.com/4igpnigee3s2/cd_s1051_dahliaharlow_ballbusting.jpg)
https://img202.imagetwist.com/th/45051/kgum8537g8wr.jpg (https://imagetwist.com/kgum8537g8wr/FkataPFI.jpg)

Description:
Mistress Dahlia and Goddess Harlow know their slave is in serious trouble as they find him hiding in the bushes. How dare he laugh at another slave_s fortune for losing the pony cart race. Does he not know that he is no better than the losing slave? Now he will learn just how worthless he really is. Dahlia and Harlow take turns unleashing cruel kicks to their slave_s sensitive balls, sending crippling pain throughout his stomach and taunting him. There is no rule-breaking here at Clubdom and this slave will learn.
Model:
Dahlia Rain, Harlow Harrison
Studio:
Clubdom.com
Info:
File Name : cd_s1051_dahliaharlow_ballbusting.mp4
File Size : 366.3 MB
Resolution : 1280x720
Duration : 00:07:48

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/50b7bdda0ce93 (https://tezfiles.com/file/50b7bdda0ce93)

Tiered
01-17-2022, 06:53 PM
Clubdom.com- 3 Cocks Brutally Fuck One Ass
https://img119.imagetwist.com/th/44715/zaz67qapcp64.jpg (https://imagetwist.com/zaz67qapcp64/3cocksbrutallyfuckoneass.jpg)
https://img202.imagetwist.com/th/44715/ova4n5g6ac6q.jpg (https://imagetwist.com/ova4n5g6ac6q/3cocksbrutallyfuckoneass.mp4.jpg)

Description:
The Mistress_s fuck the slave silly. Make fun of his dick without mercy. Each Mistress_s take turns ramming there big cocks in the slaves man pussy. The Mistress are cruel and vicious and make him beg for more. Mistress Alexia makes sure her cock goes deep by putting him the pile driver position and fucks him. Once the Mistress_s are done they shock the slave with a cattle prod and force him back into his cage. As the Mistress leave they see one of there bound slaves that they completely forgot about. Mistress Coral apologizes for there forgetfulness by shocking the slave with the cattle prod.
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : 3cocksbrutallyfuckoneass.mp4
File Size : 232.96 MB
Resolution : 640x360
Duration : 00:10:26

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/7b0ba5a3333ee (https://tezfiles.com/file/7b0ba5a3333ee)

Tiered
01-17-2022, 06:59 PM
Clubdom.com- Strapon Punishment
https://img165.imagetwist.com/th/44656/ruxry0npljbp.jpg (https://imagetwist.com/ruxry0npljbp/cd_01_20_13_strapon.jpg)
https://img165.imagetwist.com/th/44656/78iav147l0wf.jpg (https://imagetwist.com/78iav147l0wf/cd_01_20_13_strapon.mp4.jpg)

Description:
Mistresses Simone and Esmi make good on their promise to rip their slave_s ass apart with their strapons after he lost their cock milking game. Esmi starts off by taking his ass while Simone cruelly makes him gag on her cock until drool is pouring out of his mouth. But he knows he had better get that cock wet, as it is going in his ass next

Simone fucks the bitch with no mercy, making his entire body shake as she viciously thrusts her huge cock into him again and again, laughing at his pain. To a vicious sadist like Simone, making a slave shake in pain from her cock just means more pleasure for her.
Model:
Esmi Lee, Simone Kross
Studio:
Clubdom.com
Info:
File Name : cd_01_20_13_strapon.mp4
File Size : 51.67 MB
Resolution : 640x360
Duration : 00:06:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f641b1d0ac0b9 (https://tezfiles.com/file/f641b1d0ac0b9)

Tiered
01-17-2022, 07:00 PM
Clubdom.com- Slave Hunting Part 2
https://img202.imagetwist.com/th/44718/2pacqa7xea8u.jpg (https://imagetwist.com/2pacqa7xea8u/_cartesmi.jpg)
https://img202.imagetwist.com/th/44718/083qnrjucr74.jpg (https://imagetwist.com/083qnrjucr74/_cartesmi.mp4.jpg)

Description:
So these loser thought they could go to a pool hall and picks some girls up. To bad for the losers they didn_t pick up some little girls they made the mistake and went home with two cruel Mistress_s. The Mistress_s next task for the losers will be to chauffeur them around the Mistress_s compound. The Mistress are demanding and force there chauffeur slaves to go faster and faster. The Mistress begin to race each other which means the slaves will use all there strength and endurance to go as fast as they can. The Winner gets a delightful treat of four leather boots to lick clean.
Model:
Esmi Lee, Sasha Meow
Studio:
Clubdom.com
Info:
File Name : ponycartesmi.mp4
File Size : 193.64 MB
Resolution : 640x360
Duration : 00:06:21

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/5a5f81dc7bb16 (https://tezfiles.com/file/5a5f81dc7bb16)

Tiered
01-17-2022, 07:10 PM
Clubdom.com- Trapped By Sadistic Mistress_s PT 3
https://img165.imagetwist.com/th/44670/s4d9i79lqme6.jpg (https://imagetwist.com/s4d9i79lqme6/trappedbysadisticmistressspt3.jpg)
https://img202.imagetwist.com/th/44670/hwf9yv41z932.jpg (https://imagetwist.com/hwf9yv41z932/trappedbysadisticmistressspt3.mp4.jpg)

Description:
The next punishment for the new slaves will be to jerk off in front of the Mistress_s into there own hands. The Mistress_s force the slaves to pour every drip of there wretched cum out on to there hands. The reason the Mistress_s force the slaves to milk them selves is to use there cum as lube for there strap-on_s. Now its its time for the Mistress_s to shove there lubed up up cocks into there slaves asses. The Mistress brutally fuck these slave boys and force them to tell there Mistress_s how much they like there big cocks in there ass. The Mistress fuck these boys till there nothing more then broken little girls. The Mistress_s finish off there fucking by pile driving there cocks in the slaves asses. The Mistress_s then take there cocks out the slaves asses and force them to suck there filth off there strap on cocks.
Model:
Strap-on
Studio:
Clubdom.com
Info:
File Name : trappedbysadisticmistressspt3.mp4
File Size : 170.35 MB
Resolution : 640x360
Duration : 00:07:33

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4609126c490df (https://tezfiles.com/file/4609126c490df)

Tiered
01-17-2022, 07:14 PM
Clubdom.com- Her First Fuckhole
https://img202.imagetwist.com/th/44661/ldeln0doze6i.jpg (https://imagetwist.com/ldeln0doze6i/cd_03_10_13_strapon.jpg)
https://img33.imagetwist.com/th/44661/ndfmeu29p2ny.jpg (https://imagetwist.com/ndfmeu29p2ny/cd_03_10_13_strapon.mp4.jpg)

Description:
Mistress Charli has never taken a bitch with a strapon cock before, so Mistress Vendetta grabs one of the stable bitches for her to fuck. Charli is a natural, sinking her big black cock deep into his ass while Vendetta makes the bitch gag on her cock.

Tired of doing the work, Charli orders the bitch to fuck himself, sliding back and forth between the two cocks that are impaling his holes. When she has finished with his ass, Charli wants her slave to remember just how pathetic she thinks he is, so she buries her filthy cock deep into his mouth and makes him lick his own ass juices off of it. Drool pours from the bitch_s mouth as he struggles to swallow the filth, but Charli could not care less, ramming the filthy cock deeper and deeper into his mouth as he gags. Charli has already learned that fuckholes exist only to please and amuse their Mistresses
Model:
Vendetta
Studio:
Clubdom.com
Info:
File Name : cd_03_10_13_strapon.mp4
File Size : 315.37 MB
Resolution : 1280x720
Duration : 00:06:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/cec6a82e3d225 (https://tezfiles.com/file/cec6a82e3d225)

Tiered
01-17-2022, 07:32 PM
Clubdom.com- Dahila StrapOn Fucks Man-Pussy
https://img202.imagetwist.com/th/45054/xrpes3p3j8lz.jpg (https://imagetwist.com/xrpes3p3j8lz/cd_s1090_3-3_dahliarain_lydiasupremacy_strapon.jpg)
https://img202.imagetwist.com/th/45054/f23cx190x5li.jpg (https://imagetwist.com/f23cx190x5li/szRgso.jpg)

Description:
Goddess Dahlia Rain wants to stretch out her new slave_s man pussy with her big black cock. She forces her slave_s mouth over her huge strap on cock to lube it up before she starts pegging his slut hole. After his allotted time is up, Goddess Dahlia takes her position behind her slave and fills his tight man pussy with her black dong to make him her personal slut.
Model:
Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1090_3-3_dahliarain_lydiasupremacy_strapon.mp4
File Size : 290.8 MB
Resolution : 1280x720
Duration : 00:06:07

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ae271e924005b (https://tezfiles.com/file/ae271e924005b)

Tiered
01-17-2022, 07:33 PM
Clubdom.com- Jean Bardot_s Young Bitch
https://img119.imagetwist.com/th/45078/b6m7ikfmq5z2.jpg (https://imagetwist.com/b6m7ikfmq5z2/cd_s1260_jeanbardot_strapon.jpg)
https://img202.imagetwist.com/th/45078/akzw5txwwf3z.jpg (https://imagetwist.com/akzw5txwwf3z/UTKbouZ.jpg)

Description:
Jean Bardot is going to turn this young new slave into her fucked bitch. Jean really gives it to him. She doesn_t go easy on him. How else is he going to learn that being an owned bitch means getting fucked like one? Jean fucks him good and deep in both his slut holes until she feels he is thoroughly used. He grimaces and feels so much humiliation, but it feels so right. Being a fucked slut for Jean is just what he was meant to be.
Model:
Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s1260_jeanbardot_strapon.mp4
File Size : 307.36 MB
Resolution : 1280x720
Duration : 00:06:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/532b470502156 (https://tezfiles.com/file/532b470502156)

Tiered
01-17-2022, 07:33 PM
Clubdom.com- Dava Foxx Kate CBT with Water Jugs
https://img33.imagetwist.com/th/44826/a5970hd6rkbm.jpg (https://imagetwist.com/a5970hd6rkbm/s740davafoxxkateenglandcbtwaterjugs.jpg)
https://img202.imagetwist.com/th/44826/4l5pe7clqb19.jpg (https://imagetwist.com/4l5pe7clqb19/zkQCWdK.jpg)

Description:
Goddess Dava Foxx and Kate England are disappointed their worthless slave_s cock isn_t stretching despite all the weight they have tied to his useless slut stick, so they kick the water jugs to help him along.
Model:
Dava Foxx, Kate England
Studio:
Clubdom.com
Info:
File Name : s740davafoxxkateenglandcbtwaterjugs.mp4
File Size : 281.47 MB
Resolution : 1280x720
Duration : 00:06:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4718ba03aa876 (https://tezfiles.com/file/4718ba03aa876)

Tiered
01-17-2022, 07:34 PM
Clubdom.com- Three Mistress One Pathetic Cock For Milking
https://img119.imagetwist.com/th/44717/9oak366eugy1.jpg (https://imagetwist.com/9oak366eugy1/threemistressonepatheticcockformilking.jpg)
https://img119.imagetwist.com/th/44717/ann4ab900bjn.jpg (https://imagetwist.com/ann4ab900bjn/threemistressonepatheticcockformilking.mp4.jpg)

Description:
Kendra Kimmy and Elana have there slave bound outdoors where he belongs. The Mistress have waited a long time to milk this little bitch. The Mistress doubt this loser will be able to produce much so they know they will have to punish him either way. The Mistress_s also demand the slave cums when they tell him to. The Mistress make the slave shoots his load. He came a decent amount so they will not beat him today. The Mistress decide just to feed him his cum and leave him bound outdoors.
Model:
Elena Sin, Kendra James, Kimmylee
Studio:
Clubdom.com
Info:
File Name : threemistressonepatheticcockformilking.mp4
File Size : 254.05 MB
Resolution : 640x360
Duration : 00:08:14

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0de20e6443106 (https://tezfiles.com/file/0de20e6443106)

Tiered
01-17-2022, 07:35 PM
Clubdom.com- Militia of Femdom: Guardess Whipping
https://img119.imagetwist.com/th/45048/7463wvk0h82e.jpg (https://imagetwist.com/7463wvk0h82e/cd_s970_jeanbartdot_parisknight_natalya_whipping.j pg)
https://img202.imagetwist.com/th/45048/pk4p6ych06lm.jpg (https://imagetwist.com/pk4p6ych06lm/oHWqVutM.jpg)

Description:
General Jean Bardot and Natalya Sadici bring two helpless meat puppets out to be beaten without mercy. They begin to string a struggling slave up and are frustrated so they break him by delivering ball kicks and a nasty knee. They end up whipping not just him but both of the pathetic men because that is what we do here at the Femdom Militia. Except the women are just not finished yet. They decide the men_s balls should match their backs.
Model:
Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s970_jeanbartdot_parisknight_natalya_whipping.m p4
File Size : 417.98 MB
Resolution : 1280x720
Duration : 00:08:47

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d82962b1f3643 (https://tezfiles.com/file/d82962b1f3643)

Tiered
01-17-2022, 07:37 PM
Clubdom.com- Esmi_s Halloween 2: Pussy Serv
https://img202.imagetwist.com/th/45052/kd4tl23ptduc.jpg (https://imagetwist.com/kd4tl23ptduc/cd_s1065_2-2_esmilee_chindohw.jpg)
https://img202.imagetwist.com/th/45052/n9o4tc5m1grt.jpg (https://imagetwist.com/n9o4tc5m1grt/CRGgAcXP.jpg)

Description:
Esmi has her enslaved pleasure pets doing everything she says. She slaps one of them across the face and makes him lick and eat her pussy while the other slave watches. When he isn_t making her cum, Esmi makes the other slave pleasure her with a dildo gag.
Model:
Esmi Lee
Studio:
Clubdom.com
Info:
File Name : cd_s1065_2-2_esmilee_chindohw.mp4
File Size : 327.95 MB
Resolution : 1280x720
Duration : 00:06:57

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e66cf4409f58d (https://tezfiles.com/file/e66cf4409f58d)

Tiered
01-17-2022, 07:40 PM
Clubdom.com- Raven Alina Fuck the Pig
https://img165.imagetwist.com/th/44826/ve708t00864v.jpg (https://imagetwist.com/ve708t00864v/s7551-3ravenbayalinalongfuckthepig.jpg)
https://img33.imagetwist.com/th/44826/nmqj1jk56y57.jpg (https://imagetwist.com/nmqj1jk56y57/KJBALSl.jpg)

Description:
Goddess Raven bay and mistress Alina Long find a poor excuse of a man tied up in the woods to a tree all tattered and torn the ladies decide to have a little fun with this looser they offer to cut him down but inform him that he will have to fuck his way to freedom by doing everything they tell him Goddess Raven hands him a blow up lamb and makes him fuck it and onk like the man pig he is completely humiliating him and making him lick his own filth up just to amuse them, and this is just the start of his day.
Model:
Alina Long, Raven Bay
Studio:
Clubdom.com
Info:
File Name : s7551-3ravenbayalinalongfuckthepig.mp4
File Size : 287.15 MB
Resolution : 1280x720
Duration : 00:06:19

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0df36a9c9e412 (https://tezfiles.com/file/0df36a9c9e412)

Tiered
01-17-2022, 07:40 PM
Clubdom.com- Jewell and Tangent Cane the Ass slave
https://img119.imagetwist.com/th/45181/tj3ed0fkju3a.jpg (https://imagetwist.com/tj3ed0fkju3a/cd_s1341_tangent_jewellmarceau_caninggaby.jpg)
https://img119.imagetwist.com/th/45181/adcim9x1xzsv.jpg (https://imagetwist.com/adcim9x1xzsv/eavbwU.jpg)

Description:
You are going to serve us well today slave. Do you know how you are going to serve us today? By bending over and taking everything weve got Goddess Tangent and Mistress Jewell are in a particularly sadistic mood today and this slave is going to pay for it. The slut of a slave signed up to be an ass slave. Little did he know that he would be serving as an ass slave in different ways than he had hoped for. Watch as the beautiful Goddess Tangent and Jewell Marceau, dressed in sexy latex outfits, beat this slut mercilessly with their canes. He will be more careful about what he signs up for next time for sure
Model:
Goddess Tangent, Jewell Marceau
Studio:
Clubdom.com
Info:
File Name : cd_s1341_tangent_jewellmarceau_caninggaby.mp4
File Size : 403.87 MB
Resolution : 1280x720
Duration : 00:08:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/901fd5d8834ac (https://tezfiles.com/file/901fd5d8834ac)

Tiered
01-17-2022, 07:42 PM
Clubdom.com- Conquered by Cane and Cock
https://img119.imagetwist.com/th/44822/bzs3mnxgzf2r.jpg (https://imagetwist.com/bzs3mnxgzf2r/s545_kendra_alexa_rydell_canning_strap_on.jpg)
https://img119.imagetwist.com/th/44822/ybyl07tayy6h.jpg (https://imagetwist.com/ybyl07tayy6h/nmoJGe.jpg)

Description:
Kendra James and Alexis Rydell enjoy humiliating their male bitches. The ladies cane and crop the _ as they fuck them in the ass. Kendra and Alexis take great pleasure in conquering the male bitches with their strap on dicks.
Model:
Alexa Rydell, Kendra James
Studio:
Clubdom.com
Info:
File Name : s545_kendra_alexa_rydell_canning_strap_on.mp4
File Size : 315.56 MB
Resolution : 1280x720
Duration : 00:06:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c53fece2ef7d5 (https://tezfiles.com/file/c53fece2ef7d5)

Tiered
01-17-2022, 07:47 PM
Clubdom.com- Ball Busting Bag
https://img202.imagetwist.com/th/45171/v0mrv4xmeo5e.jpg (https://imagetwist.com/v0mrv4xmeo5e/movie309cfs.jpg)
https://img202.imagetwist.com/th/45172/1hsj48ekg8l8.jpg (https://imagetwist.com/1hsj48ekg8l8/oJgDpXR.jpg)

Description:
Cheyenne has her slave helplessly restrained. He is in a neck and wrist stock with his ankles restrained spread eagle. He cannot dodge her brute force punch and blows. He can also not see them coming. Cheyenne preys on his helplessness, kicking and punching the slave from every angle. She loves busting his helples balls.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie309cfs.mp4
File Size : 33.46 MB
Resolution : 640x480
Duration : 00:02:50

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/df771a75749e9 (https://tezfiles.com/file/df771a75749e9)

Tiered
01-17-2022, 07:55 PM
Clubdom.com- Lexi Kelly StrapOn Fucking
https://img119.imagetwist.com/th/45049/gsjchmv6acwo.jpg (https://imagetwist.com/gsjchmv6acwo/cd_s997_lexiluna_kellypaige_strapontoby.jpg)
https://img202.imagetwist.com/th/45049/1gckt25bs8xm.jpg (https://imagetwist.com/1gckt25bs8xm/SNCQFKJW.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Kelly Paige, Lexi Luna
Studio:
Clubdom.com
Info:
File Name : cd_s997_lexiluna_kellypaige_strapontoby.mp4
File Size : 315.46 MB
Resolution : 1280x720
Duration : 00:06:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/62c62909262da (https://tezfiles.com/file/62c62909262da)

Tiered
01-17-2022, 07:56 PM
Clubdom.com- Rubbing Your Dicklet
https://img202.imagetwist.com/th/45040/0t6c300swqe3.jpg (https://imagetwist.com/0t6c300swqe3/s889michellelacynatalyasadiciisobeldevillydiasupre macy3domspov1.jpg)
https://img119.imagetwist.com/th/45040/mhj5dinv6k15.jpg (https://imagetwist.com/mhj5dinv6k15/ylMcJL.jpg)

Description:
Mistress Natalya Sadici and Michelle Lacy and Lydia Supremacy no what a little dick loser you are and that you can_t stop stroking your tiny dicklet, They encourage you to rub your little clitty laughing the whole time as they count you down from five, To watch you dribble out that tiny pathetic load.
Model:
Isobel Devi, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s889michellelacynatalyasadiciisobeldevillydiasupre macy3domspov1.mp4
File Size : 300.9 MB
Resolution : 1280x720
Duration : 00:06:24

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6cdf54d3b998e (https://tezfiles.com/file/6cdf54d3b998e)

Tiered
01-17-2022, 08:02 PM
Clubdom.com- Pool Boy Turned Bitch-Part 1 Kicking His Useless Cock
https://img119.imagetwist.com/th/44718/msoqxcv0n15z.jpg (https://imagetwist.com/msoqxcv0n15z/poolboyturnedbitchpart1.jpg)
https://img119.imagetwist.com/th/44719/uwsjrppiafze.jpg (https://imagetwist.com/uwsjrppiafze/poolboyturnedbitchpart1.mp4.jpg)

Description:
The pool boy is cleaning the pool when Mistress Cage and Mistress Calypso interrupt him. The Mistress recognize that this loser is an mediocre rock star in the band The Ball Busters The Mistress_s invite the pool boy inside to have some fun with him. This pathetic pool boyRocker has no idea what he is in for. The Mistress_s bound the pool boy_s wrist and begin to play with his cock. The Mistress_ jerk his cock while they let him know what evil tasks they have in store for him through out the day. The Mistress_s begin to get more rough with the loser as they jerk his cock by hitting him and humiliating him. The Mistress grow tired of playing with the losers worthless cock and decode kicking his balls will be more fun.
Model:
Callie Calypso, Vanessa Cage
Studio:
Clubdom.com
Info:
File Name : poolboyturnedbitchpart1.mp4
File Size : 220.64 MB
Resolution : 640x360
Duration : 00:07:10

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/75a9092c7e70d (https://tezfiles.com/file/75a9092c7e70d)

Tiered
01-17-2022, 08:02 PM
Clubdom.com- Alexis Fawx Dava Foxx POV1
https://img165.imagetwist.com/th/44835/3c81fl6c5ict.jpg (https://imagetwist.com/3c81fl6c5ict/s820alexisfawxdavafoxxpov1.jpg)
https://img69.imagetwist.com/th/44835/p3mdpahciyf7.jpg (https://imagetwist.com/p3mdpahciyf7/tBXGhhn.jpg)

Description:
Dava sees that little worm of yours growing and your hands reaching to touch it. Alexis gets a laugh out of seeing you touch it so she tells you to go ahead and stroke it. Your tiny little dicklet, Loser, can_t do anything but be touched by your own hands. So keep playing with your sissy-stick, because no woman would have use for that tiny slut-stick.... thats why Your mistresses will let you watch them and tell you how to spill your own filth But no one wants to see that nastiness, so you have to lick it up, of course.
Model:
Alexis Fawx, Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s820alexisfawxdavafoxxpov1.mp4
File Size : 307.07 MB
Resolution : 1280x720
Duration : 00:06:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f042bfbc4c8d6 (https://tezfiles.com/file/f042bfbc4c8d6)

Tiered
01-17-2022, 08:19 PM
Clubdom.com- Brat Doms Slave Dinner
https://img119.imagetwist.com/th/45070/6mslr2kqezrx.jpg (https://imagetwist.com/6mslr2kqezrx/cd_s643_2-3_mena_li_racheal_madori.jpg)
https://img202.imagetwist.com/th/45071/tqh80zax1ajj.jpg (https://imagetwist.com/tqh80zax1ajj/zzdTQx.jpg)

Description:
Goddess Mena Li and Goddess Rachael Madori lock their little latex slave in the kitchen pantry while playing with his friend Bobby, that is under the impression its dinner time. Little does he know the Goddesses have another kind of meal in store for him. Shaking and terrified, they bring him out to play, laying him down on the table to prove his willingness, and worthiness. Goddess Mena strokes his pathetic dick, while Goddess Rachael moans in ecstasy from making him eat her pussy, getting it all juicy and wet. The Goddesses switch places on their new slave and finally giving him permission to spill his disgusting filth all over himself, making him eat it instead of the meal he thought he was going to get.
Model:
Mena Li, Mistress Rachael
Studio:
Clubdom.com
Info:
File Name : cd_s643_2-3_mena_li_racheal_madori.mp4
File Size : 315.22 MB
Resolution : 1280x720
Duration : 00:06:41

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d5dada178018e (https://tezfiles.com/file/d5dada178018e)

Tiered
01-17-2022, 08:24 PM
Clubdom.com- Bound Bitch is Milked
https://img33.imagetwist.com/th/44734/b2rl9zdt2kb8.jpg (https://imagetwist.com/b2rl9zdt2kb8/jamievalentineharleydeanmilkingslave.jpg)
https://img33.imagetwist.com/th/44736/qotqzjzix5kr.jpg (https://imagetwist.com/qotqzjzix5kr/jamievalentineharleydeanmilkingslave.mp4.jpg)

Description:
Jamie Valentine and Harley Dean torment a bound milking bitch. The ladies tease his cock with their soft hands and then, as soon as it is rock hard, they smack is cock and squeeze is balls. The ladies enjoy the power they have over this male slut. Finally, Jamie takes the bitch_s balls and holds him tightly as Harley over powers his balls with her soft hands. The ladies extract every bit of male filth from this slut. Jamie gives his balls an extra squeeze to make sure every bit of cum is choked right out.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : jamievalentineharleydeanmilkingslave.mp4
File Size : 360.09 MB
Resolution : 1280x720
Duration : 00:07:37

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b29a2029af1a2 (https://tezfiles.com/file/b29a2029af1a2)

Tiered
01-17-2022, 08:25 PM
Clubdom.com- Cherry Alina Pony Cart Boot Worship
https://img119.imagetwist.com/th/44824/lcd3ru130m0m.jpg (https://imagetwist.com/lcd3ru130m0m/s629cherryalina_cartbootworship.jpg)
https://img69.imagetwist.com/th/44824/9x1tqw4npf3e.jpg (https://imagetwist.com/9x1tqw4npf3e/qViXHBg.jpg)

Description:
When you have acres and acres of land like the sprawling Club Dom estate, it makes sense that a Goddess would need a fitting method of transportation. Naturally Mistresses Cherry Morgan and Alina Long have two willing pony boys eagerly waiting to take them all around the property. After a tour and race, the Goddesses grow bored and decide some boot worship is in order The extremely lucky slaves are overjoyed to be allowed the privilege of running their tongues all over the glistening boots of their Goddess. Mistress Cherry and Alina encourage their boot _ to continue paying tribute to them by cleaning every inch of their magnificent boots, including licking the filthy soles Both Mistresses stand over their boot bitches as they look up at the amazing bodies of both Goddesses with awe. Unsatisfied, the Domes demand the man whores suck and swallow the entire heel of their boots, making love and orally pleasing every spiked inch. They allow no mercy on their bitches, driving their heels down their whole throats. Finally satiated, Goddesses Cherry and Alina decide the boot _ have done an adequate job and demand they carry their pony carts back to the mansion.
Model:
Alina Long, Cherry Morgan
Studio:
Clubdom.com
Info:
File Name : s629cherryalinaponycartbootworship.mp4
File Size : 316.01 MB
Resolution : 1280x720
Duration : 00:06:40

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/48c30f8105708 (https://tezfiles.com/file/48c30f8105708)

Tiered
01-17-2022, 08:28 PM
Clubdom.com- Release Him From Chastity
https://img202.imagetwist.com/th/45176/dikiqijtxd2f.jpg (https://imagetwist.com/dikiqijtxd2f/movie300.jpg)
https://img202.imagetwist.com/th/45176/gdxlnyybmzzb.jpg (https://imagetwist.com/gdxlnyybmzzb/uFhZYaDJ.jpg)

Description:
Lady Cheyenne canes a slave, agreeing to release him from chastity after he takes a sound beating
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie300.wmv
File Size : 14.84 MB
Resolution : 320x240
Duration : 00:04:00

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/721149643a6a0 (https://tezfiles.com/file/721149643a6a0)

Tiered
01-17-2022, 08:32 PM
Clubdom.com- Dava Kylie StrapOn Smoking
https://img33.imagetwist.com/th/44824/yupiexlinwti.jpg (https://imagetwist.com/yupiexlinwti/s623davakyliestraponsmoking.jpg)
https://img33.imagetwist.com/th/44824/wy46ajlr3nvv.jpg (https://imagetwist.com/wy46ajlr3nvv/xkKVDWyc.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s623davakyliestraponsmoking.mp4
File Size : 398.44 MB
Resolution : 1280x720
Duration : 00:08:26

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/37c7aa166e120 (https://tezfiles.com/file/37c7aa166e120)

Tiered
01-17-2022, 08:32 PM
Clubdom.com- Finger Your Ass For Permission To Cum
https://img119.imagetwist.com/th/45076/a01a6444c37f.jpg (https://imagetwist.com/a01a6444c37f/cd_s1182_cleo_pov1.jpg)
https://img202.imagetwist.com/th/45076/wj8i95plud6t.jpg (https://imagetwist.com/wj8i95plud6t/dhomHG.jpg)

Description:
Goddess Cleo is smacking her riding crop in her hand before she commands your pathetic loser ass to get closer to her. She is going to have a bit of fun with your tiny dick. Cleo knows you want to see more of her hot body, and jerk off thinking about being able to touch a Goddess. But a loser like you, with a tiny dicklette, will never be allowed near a tight wet pussy like Goddess Cleo_s. She may let you stroke your disgusting cock if you finger your ass for her. Goddess Cleo still isn_t happy with that, so she commands you to shove four fingers in your ass, and maybe then she_ll let you touch yourself. You can_t cum until she gives you permission.
Model:
Cleo
Studio:
Clubdom.com
Info:
File Name : cd_s1182_cleo_pov1.mp4
File Size : 270.39 MB
Resolution : 1280x720
Duration : 00:05:43

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/9d997d0aafa10 (https://tezfiles.com/file/9d997d0aafa10)

Tiered
01-17-2022, 08:40 PM
Clubdom.com- Worship Your Cuckoldress
https://img119.imagetwist.com/th/45082/5igsmjonfwcf.jpg (https://imagetwist.com/5igsmjonfwcf/cd_s103_ass_worship.jpg)
https://img119.imagetwist.com/th/45082/h3sedy7croci.jpg (https://imagetwist.com/h3sedy7croci/QiZkUf.jpg)

Description:
Ashley Edmonds is going to have her ass worshipped by her cuckold husband. He needs to worship her ass properly if he wants to be kept around. She could easily have other men, they all fall at her feet. She can get any man she wants. Her cuckold husband can only have access to her ass. He can only have her pussy if he is cleaning a cream pie out of it from a better man with a larger cock.
Model:
Ashley Edmonds
Studio:
Clubdom.com
Info:
File Name : cd_s103_ass_worship.mp4
File Size : 334.4 MB
Resolution : 1280x720
Duration : 00:07:00

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/efcfc96bb5f4c (https://tezfiles.com/file/efcfc96bb5f4c)

Tiered
01-17-2022, 08:44 PM
Clubdom.com- Cherry Kylie Rogue: Fuck My Pussy Slave
https://img165.imagetwist.com/th/44829/g2d05jinjemx.jpg (https://imagetwist.com/g2d05jinjemx/s763cherrymorgankylieroguechindo.jpg)
https://img33.imagetwist.com/th/44829/n8f4ht44hmtw.jpg (https://imagetwist.com/n8f4ht44hmtw/zXiGjNl.jpg)

Description:
Goddess Kylie Rogue and Goddess Cherry Morgan are going to make their pathetic slaves useful today they have strapped up the slut boys with a chindo and instruct these useless _ to fuck their pussies and make their Goddesss cum, The slaves heads are bouncing up and down like a basketball in and out of their Goddess_s wet pink pussies. finally, the woman have reached their orgasms and tell the _ that next they may just have to fuck some man pussy.
Model:
Cherry Morgan, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s763cherrymorgankylieroguechindo.mp4
File Size : 382.28 MB
Resolution : 1280x720
Duration : 00:08:09

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b0ea96a690b09 (https://tezfiles.com/file/b0ea96a690b09)

Tiered
01-17-2022, 08:47 PM
Clubdom.com- A Painful Cruel Milking
https://img119.imagetwist.com/th/44669/2pktxv5ksc6m.jpg (https://imagetwist.com/2pktxv5ksc6m/apainfulcruelmilking.jpg)
https://img119.imagetwist.com/th/44669/4kv9tq0v6ib5.jpg (https://imagetwist.com/4kv9tq0v6ib5/apainfulcruelmilking.mp4.jpg)

Description:
Its been 37 days since the slave has been miked. The Mistress_s are furious because he has gotten hard without permission. The Mistress want to see how full his balls really are so they are going to milk him. The Mistress_s are digusted that they even have to touch his cock so they make sure the slave shows hi appreciation. Goddess Brianna see how full the slaves balls are so she squeezes them as he gets his cocked stroked by Mistress Karla. The Goddess grab the slaves balls hard to make sure he does not enjoy this cock stroking. Goddess Brianna lets the slave know of he does not produce bug load his balls will get punched The slave blows his oad. Mistress Karla is furious with his cum shot and makes him clean his filth of his hands. Goddess Brianna warned the slave that he better produce a big load and he failed. Goddess Brianna decides not to punch balls but instead to squeeze them and jam her finger into them. The slave can do nothing but whimper from the immense pain.
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : apainfulcruelmilking.mp4
File Size : 157.39 MB
Resolution : 640x360
Duration : 00:07:04

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/65c310ef17b4a (https://tezfiles.com/file/65c310ef17b4a)

Tiered
01-17-2022, 09:05 PM
Clubdom.com- Paris Knight: Face-Sitting Box
https://img202.imagetwist.com/th/45048/a0qz6y420ph5.jpg (https://imagetwist.com/a0qz6y420ph5/cd_s975_jeanbardot_parisknight_smotherbox.jpg)
https://img202.imagetwist.com/th/45048/kysvsfpwz7fe.jpg (https://imagetwist.com/kysvsfpwz7fe/eeKMpZJw.jpg)

Description:
Paris has her oral pleasure slave restrained inside the face-sitting box. She teases her slave at first, showing him her sweet pussy and ass. Then she sits on his face, only allowing him to lick her gorgeous ass, while she plays with her pussy. He cannot reach her pussy as he is just stuck in this box.
Model:
Paris Knight
Studio:
Clubdom.com
Info:
File Name : cd_s975_jeanbardot_parisknight_smotherbox.mp4
File Size : 473.69 MB
Resolution : 1280x720
Duration : 00:10:02

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/90bee7af4084e (https://tezfiles.com/file/90bee7af4084e)

Tiered
01-17-2022, 09:06 PM
Clubdom.com- Miss Ropers Dungeon Slave: Caned
https://img202.imagetwist.com/th/45185/4k7dncxol6i8.jpg (https://imagetwist.com/4k7dncxol6i8/cd_s1364_raquelroper_caning.jpg)
https://img119.imagetwist.com/th/45185/tghus2frjpgt.jpg (https://imagetwist.com/tghus2frjpgt/VyVwyJm.jpg)

Description:
Miss Roper explains to her slave that the whipping that he received was just a warmup. She tells him that the caning that she is going to give his ass will make the whipping seem pale in comparison. Miss Roper laughs as she tells her now terrified slave that she loves destroying ass more than any other body part. The bitch is secured to the caning bench with his sore balls still tightly bound in rope. Miss Roper begins the beating by lightly hitting her slaves ass with several cane strokes. She lets her bitch know that his ass belongs to her She can fuck it, spank it, slap it, cane it or anything else she may feel like doing. The fierce caning continues as her slave kicks, thrashes, cries and screams. Finally, Miss Roper walks away from her helpless bound slave, satisfied by the red cane marks that cover her bitchs ass. Her slave is left wondering, if she will come back?
Model:
Miss Roper
Studio:
Clubdom.com
Info:
File Name : cd_s1364_raquelroper_caning.mp4
File Size : 292.59 MB
Resolution : 1280x720
Duration : 00:06:12

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/646409f17888f (https://tezfiles.com/file/646409f17888f)

Tiered
01-17-2022, 09:07 PM
Clubdom.com- Every Hard Inch
https://img119.imagetwist.com/th/45182/5rvw5tt6rfjq.jpg (https://imagetwist.com/5rvw5tt6rfjq/movie104cfs.jpg)
https://img202.imagetwist.com/th/45182/qyqdo3kfjvsg.jpg (https://imagetwist.com/qyqdo3kfjvsg/HYVAAXkX.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie104cfs.mp4
File Size : 39.26 MB
Resolution : 640x480
Duration : 00:03:22

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/08800835e71be (https://tezfiles.com/file/08800835e71be)

Tiered
01-17-2022, 09:12 PM
Clubdom.com- Harlow Harrison Cage-Free Caning
https://img202.imagetwist.com/th/45056/cq3co9q3p3me.jpg (https://imagetwist.com/cq3co9q3p3me/cd_s1106_harlowharrison_caning.jpg)
https://img202.imagetwist.com/th/45056/u3qy4gv7iam2.jpg (https://imagetwist.com/u3qy4gv7iam2/lqSNzv.jpg)

Description:
Goddess Harlow Harrison wants to have some fun with her slave today. She takes the pathetic slave out of his cage and proceeds to give him a hard caning on his pale ass. She loves the smacking sound her caning creates. Her slave moves around too much, so Goddess Harlow is forced to restrain him while she punishes him for his insolence.
Model:
Harlow Harrison
Studio:
Clubdom.com
Info:
File Name : cd_s1106_harlowharrison_caning.mp4
File Size : 423.26 MB
Resolution : 1280x720
Duration : 00:08:57

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e67fc6272458b (https://tezfiles.com/file/e67fc6272458b)

Tiered
01-17-2022, 09:28 PM
Clubdom.com- Hurt Your Cock
https://img202.imagetwist.com/th/44656/fz2olhn76wu1.jpg (https://imagetwist.com/fz2olhn76wu1/cd_01_27_13_femdompov.jpg)
https://img165.imagetwist.com/th/44656/g3rn0u4p90p3.jpg (https://imagetwist.com/g3rn0u4p90p3/cd_01_27_13_femdompov.mp4.jpg)

Description:
Goddess Deanna is highly amused by slaves jerking off their tiny cocks to her beauty, especially when they are willing to suffer for the privilege. Be ready to smack your cock - torture it - even punch yourself in the balls, because whatever Deanna wants, she gets. If you hurt yourself enough, maybe it will even make Deanna wet. Then she will allow you to stroke your cock - and even use more than two fingers,if there is enough room.
Model:
Deanna Storm
Studio:
Clubdom.com
Info:
File Name : cd_01_27_13_femdompov.mp4
File Size : 39.11 MB
Resolution : 640x360
Duration : 00:04:52

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/05f2cfb15ded9 (https://tezfiles.com/file/05f2cfb15ded9)

Tiered
01-17-2022, 09:38 PM
Clubdom.com- Sex Slave For Blondes Part 6: Pleasured By Sadism
https://img202.imagetwist.com/th/45047/d9ugfkxlu7cc.jpg (https://imagetwist.com/d9ugfkxlu7cc/cd_s954_alexisfawx_parkerswayze_whippingchindo.jpg )
https://img202.imagetwist.com/th/45047/a34mji5uakg9.jpg (https://imagetwist.com/a34mji5uakg9/suBqPCJI.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Alexis Fawx, Parker Swayze
Studio:
Clubdom.com
Info:
File Name : cd_s954_alexisfawx_parkerswayze_whippingchindo.mp4
File Size : 343.69 MB
Resolution : 1280x720
Duration : 00:07:17

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/0509f04dc897f (https://tezfiles.com/file/0509f04dc897f)

Tiered
01-17-2022, 09:45 PM
Clubdom.com- Two Mistresses Edging HandJob
https://img119.imagetwist.com/th/44742/nsl10ic9ujf5.jpg (https://imagetwist.com/nsl10ic9ujf5/s447_edgeing_hj.jpg)
https://img119.imagetwist.com/th/44742/kz2ml95pu3od.jpg (https://imagetwist.com/kz2ml95pu3od/s447_edgeing_hj.mp4.jpg)

Description:
Mistress Kimmylee and Eden Alexandra enjoy milking a bound bitch. They tease and taunt his hard cock, getting it just to the point that it will explode and then backing off. Kimmylee grabs his balls and squeezes them tightly has Eden finishes the slut off, forcing him to shoot his jizz.
Model:
Eden Alexander, Kimmylee
Studio:
Clubdom.com
Info:
File Name : s447_edgeing_hj.mp4
File Size : 256.38 MB
Resolution : 1280x720
Duration : 00:05:23

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c20b099cf2e1a (https://tezfiles.com/file/c20b099cf2e1a)

Tiered
01-17-2022, 10:05 PM
Clubdom.com- Pulling on His Balls
https://img202.imagetwist.com/th/45086/api7uyhe4po7.jpg (https://imagetwist.com/api7uyhe4po7/movie506.jpg)
https://img119.imagetwist.com/th/45086/ci2cwt3rbwm7.jpg (https://imagetwist.com/ci2cwt3rbwm7/QVkTsFW.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie506.wmv
File Size : 6.77 MB
Resolution : 320x240
Duration : 00:01:49

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/04d5072f54cc0 (https://tezfiles.com/file/04d5072f54cc0)

Tiered
01-17-2022, 10:07 PM
Clubdom.com- Teased Part 2
https://img119.imagetwist.com/th/45167/5deljvk9z2rb.jpg (https://imagetwist.com/5deljvk9z2rb/movie536.jpg)
https://img119.imagetwist.com/th/45167/attg1gehgf8o.jpg (https://imagetwist.com/attg1gehgf8o/HQzbBdC.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie536.wmv
File Size : 5.04 MB
Resolution : 320x240
Duration : 00:01:23

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/8d036a87c9934 (https://tezfiles.com/file/8d036a87c9934)

Tiered
01-17-2022, 10:16 PM
Clubdom.com- Earn Your Orgasm Slave Part 3
https://img202.imagetwist.com/th/45168/6kw4rka6pmir.jpg (https://imagetwist.com/6kw4rka6pmir/fRJAAgp.jpg)
https://img119.imagetwist.com/th/45168/zmacanjws8zy.jpg (https://imagetwist.com/zmacanjws8zy/qlFOmh.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie560.wmv
File Size : 14.05 MB
Resolution : 320x240
Duration : 00:03:47

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/23fda79660f9b (https://tezfiles.com/file/23fda79660f9b)

Tiered
01-17-2022, 10:16 PM
Clubdom.com- A Slaves Monthly Milking
https://img119.imagetwist.com/th/44668/d1lth43rrg14.jpg (https://imagetwist.com/d1lth43rrg14/aslavesmonthlymilking.jpg)
https://img33.imagetwist.com/th/44668/e3s6yi6bf2lf.jpg (https://imagetwist.com/e3s6yi6bf2lf/aslavesmonthlymilking.mp4.jpg)

Description:
A Slaves Monthly Milking
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : aslavesmonthlymilking.mp4
File Size : 144.54 MB
Resolution : 640x360
Duration : 00:06:27

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/7b3122bd2eafe (https://tezfiles.com/file/7b3122bd2eafe)

Tiered
01-17-2022, 10:19 PM
Clubdom.com- Strap On Fuck Fest
https://img119.imagetwist.com/th/44745/uuvshidowbkp.jpg (https://imagetwist.com/uuvshidowbkp/s476_strap_on_vanessa_alexa_riley.jpg)
https://img69.imagetwist.com/th/44745/u4bve2pmsucc.jpg (https://imagetwist.com/u4bve2pmsucc/s476_strap_on_vanessa_alexa_riley.mp4.jpg)

Description:
Goddess Vanessa and Alexa Riley enjoy banging their bitch_s asses in what turns out to be an all out strap on fuck fest. The ladies bend the slut_s over and drive their big cocks right into the bitch_s love holes. For additional humiliation, Alexa pulls her slut_s own dicklett and balls out behind him as she rides his ass. Alexa simply glows as she utterly emasculates her fuck toy. Then the ladies put the slut_s on their backs and pile drive their man cunts, laughing and enjoying every inch of fun.
Model:
Humiliation, Strap-on
Studio:
Clubdom.com
Info:
File Name : s476_strap_on_vanessa_alexa_riley.mp4
File Size : 286.3 MB
Resolution : 1280x720
Duration : 00:06:04

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/109eca7a2680d (https://tezfiles.com/file/109eca7a2680d)

Tiered
01-17-2022, 10:27 PM
Clubdom.com- Small Men Suck Dick
https://img119.imagetwist.com/th/45051/xhy95xwy0ft3.jpg (https://imagetwist.com/xhy95xwy0ft3/cd_s1044_qandisa_amadahy_pov2.jpg)
https://img119.imagetwist.com/th/45051/f121tb0z0m6b.jpg (https://imagetwist.com/f121tb0z0m6b/BFwktNzb.jpg)

Description:
The man with the biggest dick in the room gets to fuck says Goddess Amadahy. Amadahy and Queen Qandisa both laugh as they see that you are obviously not the man that gets that privilege, not with that tiny excuse for a cock. Instead of fucking, you get FUCKED by strap-ons. These women are going to over-power you and stuff your holes with hard, femdom dick until you feel completely full, stretched and owned.
Model:
Goddess Amadahy, Queen Qandisa
Studio:
Clubdom.com
Info:
File Name : cd_s1044_qandisa_amadahy_pov2.mp4
File Size : 227.59 MB
Resolution : 1280x720
Duration : 00:04:51

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/7db386630f5e9 (https://tezfiles.com/file/7db386630f5e9)

Tiered
01-17-2022, 10:37 PM
Clubdom.com- Alexia Tyler Masturbation Instruction
https://img202.imagetwist.com/th/44822/qbeue5362u7i.jpg (https://imagetwist.com/qbeue5362u7i/s539_alexia_jordon_tyler_marie_alina_long_pov.jpg)
https://img202.imagetwist.com/th/44822/clwd0ggxo8ib.jpg (https://imagetwist.com/clwd0ggxo8ib/RIjDAk.jpg)

Description:
Goddess Alexia and Tyler have there huge black strap-on cocks out and ready to go. They are going to tell you what to do with two 10 in black hard cocks. First, instructing you to suck on it like the little slut you are. Alexia is going to make you gag on it and suck on it till she commands you to bend over. Goddess Tyler then takes over shoving her big black cock deep into your ass hole. She is gonna fuck you like a little slut and invite Goddess Alexia to shove her strap-on in your mouth while she fucks you. Goddess Tyler Marie lets you know your little asshole is hers and she will be as ruthless as she wants. After a proper pounding they give you permission to spill your pathetic man goo all over their boots and lick up every last drop.
Model:
Alexia Jordan, Tyler Marie
Studio:
Clubdom.com
Info:
File Name : s539_alexia_jordon_tyler_marie_alina_long_pov.mp4
File Size : 271.02 MB
Resolution : 1280x720
Duration : 00:05:43

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/5e2fa66c5467b (https://tezfiles.com/file/5e2fa66c5467b)

Tiered
01-17-2022, 10:48 PM
Clubdom.com- Femdom Deception PT 4
https://img202.imagetwist.com/th/44669/mthvxty5d30u.jpg (https://imagetwist.com/mthvxty5d30u/femdomdeceptionpt4.jpg)
https://img165.imagetwist.com/th/44669/mgjopn3oswa8.jpg (https://imagetwist.com/mgjopn3oswa8/femdomdeceptionpt4.mp4.jpg)

Description:
Mistress Esmi and Mistress Mia show the losers who_s gonna be doing the fucking. The losers actually thought they were gonna fuck these two beautiful goddess. The Mistress_s show whos getting by fucking there man pussies raw. The Mistress brutally fuck there ass hard and can care less how much pain they feel. The Mistress taunt and humiliate as they destruct there asses. The Mistress makes sure they feed the losers there cocks after they been deep in the losers assholes.
Model:
Esmi Lee, Mia Martinez
Studio:
Clubdom.com
Info:
File Name : femdomdeceptionpt4.mp4
File Size : 149.72 MB
Resolution : 640x360
Duration : 00:06:46

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a64af7294c972 (https://tezfiles.com/file/a64af7294c972)

Tiered
01-17-2022, 10:49 PM
Clubdom.com- Severe Paddling is Your Punishment
https://img202.imagetwist.com/th/44823/p71dt31acrei.jpg (https://imagetwist.com/p71dt31acrei/s587michellelacybriannaspanking.jpg)
https://img69.imagetwist.com/th/44823/emx23hn104dn.jpg (https://imagetwist.com/emx23hn104dn/rzsURsa.jpg)

Description:
Goddess Michelle Lacy as instructed her residence slave Bart to sweep and clean the dungeon. After closer inspection she sees that he has done a horrible job and he must be punished. She leads the bitch in on a leash and then bends him right over her lap. Spanking his bare ass with her hand explaining to him this is the only way you will learn. Feeling this is not severe enough she instructs the slave to grab his ankles. Goddess pulls out the paddle continuing with multiple strikes across the bitches red ass. The leaving him to finish his duties of cleaning the dungeon. She mentions to slave Alex, why can_t they all be more just like you. Alex asks for permission to speak. Goddess says yes Alex go ahead Alex says I believe it was actually my turn to clean the dungeon. Michelle laughs and says oh well, no problem. As slave Bart looks back humiliated and embarrassed Michelle yells keep sweeping bitch
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s587michellelacybriannaspanking.mp4
File Size : 246.14 MB
Resolution : 1280x720
Duration : 00:05:15

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/9162d8a8a60e0 (https://tezfiles.com/file/9162d8a8a60e0)

Tiered
01-17-2022, 10:56 PM
Clubdom.com- Sex Slave For Blondes Part 2: Seduced to Fuck
https://img119.imagetwist.com/th/45046/nm8k46w4q3jg.jpg (https://imagetwist.com/nm8k46w4q3jg/cd_s951_2-3_alexisfawx_parkerswayze_bg1.jpg)
https://img119.imagetwist.com/th/45046/a5x2axrab801.jpg (https://imagetwist.com/a5x2axrab801/lXHVYzc.jpg)

Description:
The two hot blonde Mistresses are horny from all of the ass licking and now want their new sex slave to fuck them both. They can_t have him going limp on them so they seduce him to stay hard by giving him a huge shot into his balls. If he cums, his balls will fall off so he must stay hard for them. They seduce him to fuck Mistress Alexis Faux until she is satisfied but they aren_t finished, Mistress Parker is next.
Model:
Alexis Fawx, Parker Swayze
Studio:
Clubdom.com
Info:
File Name : cd_s951_2-3_alexisfawx_parkerswayze_bg1.mp4
File Size : 298.99 MB
Resolution : 1280x720
Duration : 00:05:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/9233a8c305060 (https://tezfiles.com/file/9233a8c305060)

Tiered
01-17-2022, 10:56 PM
Clubdom.com- Beg For A Good Caning
https://img202.imagetwist.com/th/45074/oqm7q7qe4ho2.jpg (https://imagetwist.com/oqm7q7qe4ho2/cd_s1180_cleo_caning.jpg)
https://img202.imagetwist.com/th/45074/dv9bbwth8k0r.jpg (https://imagetwist.com/dv9bbwth8k0r/RbynDRn.jpg)

Description:
Goddess Cleo calls her slave over, and asks him what his sole purpose is to serve his goddess in any way. Cleo has him get up on the caning chair. His ass is so plain and boring, but Goddess Cleo is going to change that with her cane. She gives it a few little soft taps to warm it up before making him beg to get caned. She winds up for a good whack and unleashes her cane on his ass. Goddess Cleo loves to hear him beg to get caned, but he does it so pathetically. She canes him for being so insubordinate. His ass is starting to turn red, but that doesn_t mean Goddess Cleo is going to stop.
Model:
Cleo
Studio:
Clubdom.com
Info:
File Name : cd_s1180_cleo_caning.mp4
File Size : 277.92 MB
Resolution : 1280x720
Duration : 00:05:53

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e625325b2fa25 (https://tezfiles.com/file/e625325b2fa25)

Tiered
01-17-2022, 10:57 PM
Clubdom.com- Fuck My Feet
https://img119.imagetwist.com/th/45172/jin1zfe1h5b9.jpg (https://imagetwist.com/jin1zfe1h5b9/movie402cfs.jpg)
https://img202.imagetwist.com/th/45172/3ejwx71fxjzv.jpg (https://imagetwist.com/3ejwx71fxjzv/zghEgYK.jpg)

Description:
Lady Cheyenne has just come from her garden. Her feet are still a bit soiled, however dainty in her beaded sandals. She informs her bitch that he is now a foot fag, no longer permitted to look above a woman_s knee. Cheyenne flexes her high arches in her sandals and instructs her foot fag to slide his cock. The tight space between the soul of her foot and her sweaty sandal is nice and warm. It is as close to intercourse as he_ll ever get. She demands he fuck in the only way she will allow. Then she puts him on his back and places his cock in between her bare feet. Cheyenne forces him to have intercourse with her feet. Her slave spills his filth on her toes. Cheyenne then forces him to lick her precious feet clean.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie402cfs.mp4
File Size : 54.17 MB
Resolution : 640x480
Duration : 00:04:36

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/bbfc2e946f9b5 (https://tezfiles.com/file/bbfc2e946f9b5)

Tiered
01-17-2022, 11:01 PM
Clubdom.com- Veronica Cohen Kylie Rogue Cage POV
https://img202.imagetwist.com/th/44835/m5y0uz132jd2.jpg (https://imagetwist.com/m5y0uz132jd2/s837veronicacohenkylieroguecagepov.jpg)
https://img165.imagetwist.com/th/44835/u8f2h17walpo.jpg (https://imagetwist.com/u8f2h17walpo/qTRCrTUI.jpg)

Description:
Get that manpussy and dicklet ready for another milking. Veronica and Kylie tell you just what they want to see to allow you to touch yourself. Go ahead and slobber up that sluthole so you can fuck yourself during the milking They are going to count you down to spilling your filth so listen closely to your orders
Model:
Kylie Rogue, Veronica Snow
Studio:
Clubdom.com
Info:
File Name : s837veronicacohenkylieroguecagepov.mp4
File Size : 273.68 MB
Resolution : 1280x720
Duration : 00:05:46

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d7dfa881c8673 (https://tezfiles.com/file/d7dfa881c8673)

Tiered
01-17-2022, 11:08 PM
Clubdom.com- Mistress Brutality
https://img119.imagetwist.com/th/44669/8pory70szvy7.jpg (https://imagetwist.com/8pory70szvy7/mistressbrutality.jpg)
https://img119.imagetwist.com/th/44669/8dqiup8bk71p.jpg (https://imagetwist.com/8dqiup8bk71p/mistressbrutality.mp4.jpg)

Description:
Mistress Mia, Mistress Kendra James and Mistress Amadahey stand over there slave. The Mistress_s have canes in there hands and are suited up in long boots stockings and latex. Mistress Kendra starts the brutal assault then the other Mistress_s join in. The Mistress_s do not take it easy on the loser who is bound upside down. You can hear from the slave moans the pain he is in. The Mistress_s just Cain harder and faster. The slave is bound upside down and is completely helpless. The Mistress have perfect access to his ass and take advantage of it. The Mistress make the pathetic slave thank his goddess for this torture. The Mistress beat the slave till his ass is covered in welts.
Model:
Kendra James, Mistress Mia
Studio:
Clubdom.com
Info:
File Name : mistressbrutality.mp4
File Size : 249.61 MB
Resolution : 640x360
Duration : 00:10:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/aa42c0a8dc900 (https://tezfiles.com/file/aa42c0a8dc900)

Tiered
01-17-2022, 11:09 PM
Clubdom.com- Jean_s Stretched Slut Part 4
https://img33.imagetwist.com/th/45077/w3c4i2t4lo7y.jpg (https://imagetwist.com/w3c4i2t4lo7y/cd_s1251_4-5_jean_sissystrapon.jpg)
https://img202.imagetwist.com/th/45077/69lptq4gni4m.jpg (https://imagetwist.com/69lptq4gni4m/nwloii.jpg)

Description:
Jean Bardot is on a mission to train her slut and stretch her out. She WILL make sure her holes are stretched. The sissy has been in the dungeon cage. Jean comes in with her strap-on on and sits on top of the cage, stroking her cock and telling the sissy what is in store for her. You HAVE to hear what Jean says to the sissy Jean then allows the sissy to come out of the cage and suck her cock. She also shoves it right down the sissy_s pussy.
Model:
Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s1251_4-5_jean_sissystrapon.mp4
File Size : 317.89 MB
Resolution : 1280x720
Duration : 00:06:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d3c6b0bfe11e0 (https://tezfiles.com/file/d3c6b0bfe11e0)

Tiered
01-17-2022, 11:10 PM
Clubdom.com- Hard boiled dick
https://img119.imagetwist.com/th/45176/6k35jcle5vyg.jpg (https://imagetwist.com/6k35jcle5vyg/movie981cfs.jpg)
https://img119.imagetwist.com/th/45176/ta4ld9tndogq.jpg (https://imagetwist.com/ta4ld9tndogq/ThOKkyzX.jpg)

Description:
Cheyenne has her bitch in a rubber body bag with his cock wired to an electric box. She juices up his dick and laughs as the slut squirms but is helpless to get away. After the bitch_s cock has been throughly fried, she removes the electric bands and forces him to spill his hot filth with her latex clad hands. Then she force feeds the slut his own cock juice, making him taste every bit.
Model:
Electroshock
Studio:
Clubdom.com
Info:
File Name : Movie981CFS.wmv
File Size : 57.67 MB
Resolution : 720x480 @ 810x480
Duration : 00:05:05

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/785ba482810a9 (https://tezfiles.com/file/785ba482810a9)

Tiered
01-17-2022, 11:15 PM
Clubdom.com- Pinned, Jerked and Ass Fucked
https://img119.imagetwist.com/th/45063/ep67bzx702gz.jpg (https://imagetwist.com/ep67bzx702gz/cd_s497_full_stevie_shae_kelly_diamond.jpg)
https://img202.imagetwist.com/th/45063/56986y54gbao.jpg (https://imagetwist.com/56986y54gbao/NzVizQyo.jpg)

Description:
Goddess Stevie and Diamond Kelly are brutally humiliate a male bitch on the wrestling mat. After they kick the bitch_s ass, Diamond puts him in head scissor lock with their powerful thighs. As his face turns beat red, Stevie notices that he has an erection Getting beat up by girls is actually turning this slut on Diamond sits of the slut_s face, smothering him with her beautiful but sweaty ass as Stevie begins to tease his embarrassingly hard cock. Stevie begins to stroke the slut_s cock. When the slut is rock hard the bitch is made to jerk himself off on Stevie_s feet AND lick it all up. After the slut has spilled his male filth the Stevie and Diamond violate his ass with their strap on cocks. The ladies take a special delight in degrading this bitch. They drive their cocks deep into his ass, enjoying the fact that he can still taste his own cum in his mouth as they fuck him hard.
Model:
Kelly Diamond, Stevie Shae
Studio:
Clubdom.com
Info:
File Name : cd_s497_full_stevie_shae_kelly_diamond.mp4
File Size : 868.37 MB
Resolution : 1280x720
Duration : 00:18:20

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a3b0c5e6491ef (https://tezfiles.com/file/a3b0c5e6491ef)

Tiered
01-17-2022, 11:17 PM
Clubdom.com- Kendra, Esmi and Alexa Strapon POV
https://img202.imagetwist.com/th/44822/l4mpv8ar53l9.jpg (https://imagetwist.com/l4mpv8ar53l9/s525_kendra_esmi_alexa_rydel_strapon_pov.jpg)
https://img119.imagetwist.com/th/44822/j9zll1ickqs6.jpg (https://imagetwist.com/j9zll1ickqs6/VjbMpZR.jpg)

Description:
Kendra Alexa and Esmi discover what a hungry slut you are. They demand that you get on your knees and open your mouth. They are going to face fuck you with their huge strap on dicks. Kendra notices that your own dick is getting hard. What a whore Goddess Esmi demands that you pinch precum in your hand and lube their dicks with it. That is right you will be tasting your precum as they run their dicks down your throat. Alexia decides that you should stroke your dick. The ladies agree to let you spill your male filth. There is, however, a catch to how you will cum and how you will clean up your mess, you will do it with your three fingers shoved up your pathetic man pussy.
Model:
Alexia Jordan, Esmi Lee, Kendra James
Studio:
Clubdom.com
Info:
File Name : s525_kendra_esmi_alexa_rydel_strapon_pov.mp4
File Size : 273.53 MB
Resolution : 1280x720
Duration : 00:05:46

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/06a22b95cbfa4 (https://tezfiles.com/file/06a22b95cbfa4)

Tiered
01-17-2022, 11:26 PM
Clubdom.com- Venus Smoking Burn
https://img69.imagetwist.com/th/44825/iezmioxnji0p.jpg (https://imagetwist.com/iezmioxnji0p/s711venuskyliesmokingburn.jpg)
https://img202.imagetwist.com/th/44825/njv13b511bko.jpg (https://imagetwist.com/njv13b511bko/ophkdqR.jpg)

Description:
Goddess Venus uses her slave as a human ashtray.
Model:
Venus Divine
Studio:
Clubdom.com
Info:
File Name : s711venuskyliesmokingburn.mp4
File Size : 370.3 MB
Resolution : 1280x720
Duration : 00:07:47

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1e9f5a1a944f2 (https://tezfiles.com/file/1e9f5a1a944f2)

Tiered
01-17-2022, 11:27 PM
Clubdom.com- Oral Service
https://img202.imagetwist.com/th/45182/70bhgd0wlvew.jpg (https://imagetwist.com/70bhgd0wlvew/movie100cfs.jpg)
https://img202.imagetwist.com/th/45182/6pfohhwh6byq.jpg (https://imagetwist.com/6pfohhwh6byq/IYTwhxeR.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
AIE
Studio:
Clubdom.com
Info:
File Name : movie100cfs.mp4
File Size : 53.77 MB
Resolution : 640x480
Duration : 00:04:31

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4b3a1088ad63e (https://tezfiles.com/file/4b3a1088ad63e)

Tiered
01-17-2022, 11:30 PM
Clubdom.com- Kylie Rogue Jamie Valentine Caning
https://img165.imagetwist.com/th/44831/3yeut0l1nb8d.jpg (https://imagetwist.com/3yeut0l1nb8d/s606kylieroguejamievalentinecaningbitch.jpg)
https://img165.imagetwist.com/th/44831/aizeylw6qrui.jpg (https://imagetwist.com/aizeylw6qrui/rQcBwLJf.jpg)

Description:
Goddess Kylie Rogue and Mistress Jamie Valentine are sadistic and give their male bitch a severe caning. Making him howl and bark like a dog. His ass is then used as target practice for their caning technique. After his ass is raw and red they make him thank them for the brutal caning. They throw their canes and tell the male bitch to fetch laughing as he crawls off after the canes.
Model:
Jamie Valentine, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s606kylieroguejamievalentinecaningbitch.mp4
File Size : 363.52 MB
Resolution : 1280x720
Duration : 00:07:40

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d4d75cbb886c3 (https://tezfiles.com/file/d4d75cbb886c3)

Tiered
01-17-2022, 11:34 PM
Clubdom.com- Dick Loving Whore
https://img202.imagetwist.com/th/45172/r8eujameu152.jpg (https://imagetwist.com/r8eujameu152/movie427cfs.jpg)
https://img119.imagetwist.com/th/45172/lcpk1a8ss2ww.jpg (https://imagetwist.com/lcpk1a8ss2ww/JxvTCCNs.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Jade Tiger
Studio:
Clubdom.com
Info:
File Name : movie427cfs.mp4
File Size : 90.73 MB
Resolution : 640x480
Duration : 00:07:45

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d9304b13822e1 (https://tezfiles.com/file/d9304b13822e1)

Tiered
01-17-2022, 11:36 PM
Clubdom.com- Pool Boy Turned Bitch-Part 2 Cum On Our Boots
https://img119.imagetwist.com/th/44719/ozjyavy6tvr6.jpg (https://imagetwist.com/ozjyavy6tvr6/poolboyturnedbitchpart2.jpg)
https://img202.imagetwist.com/th/44719/nlj9edff4w6b.jpg (https://imagetwist.com/nlj9edff4w6b/poolboyturnedbitchpart2.mp4.jpg)

Description:
Mistress Cage and Mistress Calypso are going to let there puppy out to do his chores. The Mistress_s need there boots cleaned and he will clean every inch with his tongue. The Mistress_s let the puppy out of his kennel. The Mistress yell at the little bitch while he cleans there tall leather boots. to insure he does a perfect job. The slave cleans there boots thoroughly with tongue. The Mistress are not done yet though. The Mistress_s make the slave cum on there boots so he has to clean them again but this time it will his own cum hes cleaning.
Model:
Callie Calypso, Vanessa Cage
Studio:
Clubdom.com
Info:
File Name : poolboyturnedbitchpart2.mp4
File Size : 237.59 MB
Resolution : 640x360
Duration : 00:07:40

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2e435b38edb55 (https://tezfiles.com/file/2e435b38edb55)

Tiered
01-17-2022, 11:41 PM
Clubdom.com- Helpless Fuck-Toy for the Guardesses
https://img119.imagetwist.com/th/45050/zc7xzmvwv5c3.jpg (https://imagetwist.com/zc7xzmvwv5c3/cd_s1011_5-5_jamievalentine_oliviafox_strapon.jpg)
https://img202.imagetwist.com/th/45050/p9x9g48w2y1i.jpg (https://imagetwist.com/p9x9g48w2y1i/MVDVxQof.jpg)

Description:
Jamie Valentine and Olivia Fox drag their prisoner back into the dungeon for more torture. This time their gorgeous breasts are exposed and they decide to relieve some frustration by fucking their slave with their enormous superior cocks. He must take both cocks, at the same time, while the girls man-handle him and verbally destroy him. He feels so used and owned as these two hot Guardesses make him weaker and weaker with their beauty...and their cocks.
Model:
Jamie Valentine
Studio:
Clubdom.com
Info:
File Name : cd_s1011_5-5_jamievalentine_oliviafox_strapon.mp4
File Size : 352.41 MB
Resolution : 1280x720
Duration : 00:07:28

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/3d3a5d114aa22 (https://tezfiles.com/file/3d3a5d114aa22)

Tiered
01-17-2022, 11:42 PM
Clubdom.com- Rilyn Rae Roxi Wrestling
https://img119.imagetwist.com/th/45081/o5gltj268x2p.jpg (https://imagetwist.com/o5gltj268x2p/cd_s682_full_rilynnrae_roxiiblair_wrestling.jpg)
https://img202.imagetwist.com/th/45081/gk16k5s69sc1.jpg (https://imagetwist.com/gk16k5s69sc1/ogmgNLxD.jpg)

Description:
NEVER RELEASED Watch these hot women take down these men. Hot women make men weak no matter how large their muscles may be
Model:
Rilynn Rae, Roxii Blair
Studio:
Clubdom.com
Info:
File Name : cd_s682_full_rilynnrae_roxiiblair_wrestling.mp4
File Size : 631.35 MB
Resolution : 1280x720
Duration : 00:13:27

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ad97c5972ea89 (https://tezfiles.com/file/ad97c5972ea89)

Tiered
01-17-2022, 11:45 PM
Clubdom.com- Conditioned by the Whip
https://img202.imagetwist.com/th/45175/z28d9safvni0.jpg (https://imagetwist.com/z28d9safvni0/HGeFecW.jpg)
https://img202.imagetwist.com/th/45175/bjoe8illemdd.jpg (https://imagetwist.com/bjoe8illemdd/lbdeNSM.jpg)

Description:
Cheyenne has her bitch restrained to a cross. It is her goal to condition this bitch not only to accept her savage whippings but actually come to enjoy them. Cheyenne cuts into the slave_s ass, back and legs with her single tail whip, causing instant raised welts and bruising. Cheyenne loves it. She knows that in time her slave will long for her whip.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie790CFS.wmv
File Size : 66.87 MB
Resolution : 640x480
Duration : 00:09:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/978405d021beb (https://tezfiles.com/file/978405d021beb)

Tiered
01-17-2022, 11:48 PM
Clubdom.com- Extract The Cum
https://img119.imagetwist.com/th/44745/mc89pg7s2wl5.jpg (https://imagetwist.com/mc89pg7s2wl5/s470_eat_your_load_hj_vanessa_alexa_riley.jpg)
https://img119.imagetwist.com/th/44745/rbldll76q7n6.jpg (https://imagetwist.com/rbldll76q7n6/s470_eat_your_load_hj_vanessa_alexa_riley.mp4.jpg)

Description:
Riley Reynolds knows how to manipulate a weak male bitch with her soft hands. She has a male slut strapped into a bondage chair with a ball gag in his mouth. She goes to work on forcing the slut to release his male filth. The bitch tries to resist but is no match for Riley_s expert hands. Once the slut_s cock starts throbbing, Riley puts a tight grip around his balls. Once he releases his male filth she will squeeze out every last drop. Riley smiles as the bitch begins to cum. She knows there is a tasty surprise waiting for him.
Model:
Riley Reynolds
Studio:
Clubdom.com
Info:
File Name : s470_eat_your_load_hj_vanessa_alexa_riley.mp4
File Size : 278.76 MB
Resolution : 1280x720
Duration : 00:05:53

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/cd078a9ea7901 (https://tezfiles.com/file/cd078a9ea7901)

Tiered
01-17-2022, 11:53 PM
Clubdom.com- Ball Busting is a Big Rush
https://img202.imagetwist.com/th/45172/cbebsuou98zg.jpg (https://imagetwist.com/cbebsuou98zg/movie320cfs.jpg)
https://img119.imagetwist.com/th/45172/kovt25cfmp2x.jpg (https://imagetwist.com/kovt25cfmp2x/rkULZs.jpg)

Description:
This is an incredible ball busting clip. Cheyenne is all worked up after a ball whipping scene. Her ball bitch is secured in a bondage chair. He can_t move a muscle to protect his balls. Cheyenne stands over him and lays into his helpless balls with her stocking foot. The slave moans and nearly melts down but Cheyenne keeps the kicks coming. She slides down the slave_s body, her stocking leg teasing the slave_s cock. For a split second he thinks she may actually be nice to him but Cheyenne lays in with more brutal kicks and gut wrenching ball punches. Throughout this clips Cheyenne is so hot for busting this man_s balls. She can_t get enough.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie320cfs.mp4
File Size : 55.53 MB
Resolution : 640x480
Duration : 00:04:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a406252c347bc (https://tezfiles.com/file/a406252c347bc)

Tiered
01-17-2022, 11:53 PM
Clubdom.com- Punishing the Cock
https://img119.imagetwist.com/th/45182/mna95z2malh9.jpg (https://imagetwist.com/mna95z2malh9/movie101cfs.jpg)
https://img202.imagetwist.com/th/45182/w0tkkj5negev.jpg (https://imagetwist.com/w0tkkj5negev/HuIhyGW.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie101cfs.mp4
File Size : 77.7 MB
Resolution : 640x480
Duration : 00:06:38

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/24b18363afbca (https://tezfiles.com/file/24b18363afbca)

Tiered
01-17-2022, 11:55 PM
Clubdom.com- Dahila Rain Alexis Grace: Fuck Meat
https://img119.imagetwist.com/th/45050/4ra8r98wygsv.jpg (https://imagetwist.com/4ra8r98wygsv/cd_s1019_dahilarain_alexisgrace_strapon.jpg)
https://img202.imagetwist.com/th/45050/mzpy2z2pi2zd.jpg (https://imagetwist.com/mzpy2z2pi2zd/OEnBOP.jpg)

Description:
Slave 040 is the lucky chosen slave to get strap-on fucked today. He waits in the cage while Goddesses Alexis and Dahlia sit on top of it, stroking their huge cocks, discussing about how they wish they had someone to fuck today, sarcastically, staring right at him. They drag him out of the cage. Alexis makes him suck her cock and lube it up with his spit You don_t want it to go in DRY, do you? He shakes his head _no_ and starts sucking her and Dahlia_s big cocks. Dahlia decides she wants to fuck him good and hard to show Alexis what she has learned. She orders the slave over the cage to get his ass reamed by her. Dahlia fucks him good and hard while Alexis laughs and taunts him. He feels so violated and used.
Model:
Alexis Grace, Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1019_dahilarain_alexisgrace_strapon.mp4
File Size : 297.42 MB
Resolution : 1280x720
Duration : 00:06:16

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/17193e1508b73 (https://tezfiles.com/file/17193e1508b73)

Tiered
01-17-2022, 11:56 PM
Clubdom.com- Venus Kylie Failed Milking
https://img165.imagetwist.com/th/44825/tqcs6v09pyuv.jpg (https://imagetwist.com/tqcs6v09pyuv/s707venuskyliecbtfailedhj.jpg)
https://img33.imagetwist.com/th/44825/rdc6bgapu4o5.jpg (https://imagetwist.com/rdc6bgapu4o5/jCBiLKlC.jpg)

Description:
Venus and Kylie think they should feed their starving slave with a big helping of protein, but decide to starve him since he won_t produce any filth from his slut sacks.
Model:
Kylie Rogue, Venus Divine
Studio:
Clubdom.com
Info:
File Name : s707venuskyliecbtfailedhj.mp4
File Size : 290.81 MB
Resolution : 1280x720
Duration : 00:06:10

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f07e0aebc24ec (https://tezfiles.com/file/f07e0aebc24ec)

Tiered
01-17-2022, 11:57 PM
Clubdom.com- Goddess Valora_s Ball Busting
https://img119.imagetwist.com/th/45069/pbtjjfhjska5.jpg (https://imagetwist.com/pbtjjfhjska5/cd_s1144_goddessvalora_ballbusting.jpg)
https://img119.imagetwist.com/th/45069/d2ndbiyne4av.jpg (https://imagetwist.com/d2ndbiyne4av/FcULkQu.jpg)

Description:
Are you nervous? purple haired Goddess Valora asks? Well, you should be, cause she wants to squish and stomp your little bitty pathetic raisin balls. Goddess Valora makes her slave beg her to destroy his balls like he wants it for Christmas. After taking off her boots, Goddess Valora lines up and kicks her slave right in his pathetic slut sacks until her falls over in pain. Not satisfied, Goddess Valora orders him to stand up to take more punishment. Goddess Valora demands her slave to display his pathetic cock and disgusting little balls to her so she can administer more ball torture. She really wants to utterly destroy her slave_s useless slut sacks. Are we having fun yet?
Model:
Goddess Valora
Studio:
Clubdom.com
Info:
File Name : cd_s1144_goddessvalora_ballbusting.mp4
File Size : 279.15 MB
Resolution : 1280x720
Duration : 00:05:57

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/cd81622b4715b (https://tezfiles.com/file/cd81622b4715b)

Tiered
01-18-2022, 12:00 AM
Clubdom.com- Alexia Jordon: Big Love
https://img119.imagetwist.com/th/44715/beijxfkjk45b.jpg (https://imagetwist.com/beijxfkjk45b/biglovealexis.jpg)
https://img119.imagetwist.com/th/44715/txpfpmmlt01a.jpg (https://imagetwist.com/txpfpmmlt01a/biglovealexis.mp4.jpg)

Description:
Mistress Alexia Jordon is horny. She straps on 10 thick inches of cock and proceeds to have her way with a stable slut. She buries her dick deep in the slut_s ass, laughing as he struggles to take every inch of her love. She fucks his man pussy in multiple positions before finishing him off in pile driver. Once Mistress is satisfied she puts the slut on his knees and demands that he lick her cock clean.
Model:
Alexia Jordan
Studio:
Clubdom.com
Info:
File Name : biglovealexis.mp4
File Size : 178.11 MB
Resolution : 640x360
Duration : 00:08:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/84c50a821af6f (https://tezfiles.com/file/84c50a821af6f)

Tiered
01-18-2022, 12:29 AM
Clubdom.com- Alina Long Sasha Femdom Sex
https://img202.imagetwist.com/th/45055/g7yrr4uxiqyy.jpg (https://imagetwist.com/g7yrr4uxiqyy/cd_s562_alina_long_sasha_sweet_bg_hj.jpg)
https://img119.imagetwist.com/th/45055/fy7fl635z0tx.jpg (https://imagetwist.com/fy7fl635z0tx/uCjKZGg.jpg)

Description:
Mistress Sasha and Goddess Alina look forward to milking day on the ClubDom Estate. They strap the slave into a bondage chair and stroke the slave_s cock nice and slow. Sasha proceeds to fuck the pathetic slave. However he is unable to keep his erection. The slave is resistant because he knows that is orgasm will ultimately be ruined and he will made to consume his own filth. As hard as the slave tries to resist the ladies seductive hands his body betrays him. Sasha catches his filth her hand. Alina holds the slave_s mouth open as smiles as Sasha force feeds the slut every last drop.
Model:
Alina Long
Studio:
Clubdom.com
Info:
File Name : cd_s562_alina_long_sasha_sweet_bg_hj.mp4
File Size : 294.05 MB
Resolution : 1280x720
Duration : 00:06:12

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d719461a44a80 (https://tezfiles.com/file/d719461a44a80)

Tiered
01-18-2022, 12:36 AM
Clubdom.com- Lydia Supremacy Strapon POV
https://img119.imagetwist.com/th/45054/nbgdgmmkvj55.jpg (https://imagetwist.com/nbgdgmmkvj55/cd_s1091_dahliarain_lydiasupremacy_lydiastrappov.j pg)
https://img202.imagetwist.com/th/45054/jyjyqb3e0klm.jpg (https://imagetwist.com/jyjyqb3e0klm/eNccJXQ.jpg)

Description:
Goddess Lydia Supremacy wants to make you her pathetic little bitch. She tells you how she_s going to skull fuck you with her big black cock. Goddess Lydia stands in front of you stroking her cock while telling you what she_s going to do to your pathetic slut hole, as she gives you instructions on how to please her.
Model:
Dahlia Rain, Lydia Supremacy
Studio:
Clubdom.com
Info:
File Name : cd_s1091_dahliarain_lydiasupremacy_lydiastrappov.m p4
File Size : 262.05 MB
Resolution : 1280x720
Duration : 00:05:35

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/673e8f6142e9e (https://tezfiles.com/file/673e8f6142e9e)

Tiered
01-18-2022, 12:36 AM
Clubdom.com- Elena_s Human Dildo Toy
https://img165.imagetwist.com/th/44656/nxltvnsb1asz.jpg (https://imagetwist.com/nxltvnsb1asz/cd_01_27_13_milking.jpg)
https://img119.imagetwist.com/th/44656/8o0qbxuhjdna.jpg (https://imagetwist.com/8o0qbxuhjdna/cd_01_27_13_milking.mp4.jpg)

Description:
Mistress Elena enjoys totally dominating slaves through their cocks and making their manhood her personal play toy. Elena teases her bound slave by sitting on his face and ordering him to smell her pussy. Elena then mercilessly teases the bitch, jerking him off and rubbing her pussy on his cock to get it rock hard.

Elena then rides the slave_s huge cock, making sure that she gets her orgasms, but then pulls it out before the slave can cum. Elena just laughs at the slave_s frustration as she jerks him to the edge again and again, only to stop once he is on the verge of cumming. Thoroughly amused with his suffering, Elena jerks the bitch until he explodes all over his belly, then leaves him bound and covered in his own filth until she has further use of him.
Model:
Elena Sin
Studio:
Clubdom.com
Info:
File Name : cd_01_27_13_milking.mp4
File Size : 52.7 MB
Resolution : 640x360
Duration : 00:06:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/50a370e0154f6 (https://tezfiles.com/file/50a370e0154f6)

Tiered
01-18-2022, 12:40 AM
Clubdom.com- Goddess Valora Owns Your Cock
https://img202.imagetwist.com/th/45068/ndsg68ubu54d.jpg (https://imagetwist.com/ndsg68ubu54d/cd_s1147_goddessvalora_pov2.jpg)
https://img202.imagetwist.com/th/45068/gvi3oacgyqn1.jpg (https://imagetwist.com/gvi3oacgyqn1/cqGETso.jpg)

Description:
Goddess Valora owns your cock, and doesn_t want you to touch it unless she explicitly tells you to. Goddess Valora wants to hear you beg to stroke your pathetic cock for her, then maybe she will let you stroke it. She knows you have a pathetic tiny dicklette, and Goddess Valora deserves a real man_s cock. Goddess Valora gets to do whatever she wants to with your little cock, whether she wants to satisfy it, or utterly torture it. She knows your cock is throbbing because it_s so close to cumming all over your hand. Goddess Valora allows you to stroke that disgusting filth out of your balls while giving you a countdown for you to spill your load.
Model:
Goddess Valora
Studio:
Clubdom.com
Info:
File Name : cd_s1147_goddessvalora_pov2.mp4
File Size : 254.06 MB
Resolution : 1280x720
Duration : 00:05:24

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c01c4f613854b (https://tezfiles.com/file/c01c4f613854b)

Tiered
01-18-2022, 12:57 AM
Clubdom.com- Edging Handjob Ends With Ball Punch
https://img119.imagetwist.com/th/44717/kic516pqd4o1.jpg (https://imagetwist.com/kic516pqd4o1/edingtuck.jpg)
https://img119.imagetwist.com/th/44717/pui275nd7l67.jpg (https://imagetwist.com/pui275nd7l67/edingtuck.mp4.jpg)

Description:
Mistress Star and Mistress winters have a nice milking slave tied up and at there disposal. This slave will need to be milked but like every other slave he will receive no special treatment. The slave will not be in the conventional sense he will be by being edged till he goes insane. The slaves cock is toyed with and brought to climax then abruptly stopped. The slave goes berserk as he cums over and over. Finally the Mistress_s allow the slave to spill his load. The slaves cock is extremely sensitive after the the edging he received. The slaves next give him a swift punch in the balls. The punch feels like a sledge hammer on his sensitive balls and makes him cry out like a weeping little girl.
Model:
Deanna Winters
Studio:
Clubdom.com
Info:
File Name : edingtuck.mp4
File Size : 205.38 MB
Resolution : 640x360
Duration : 00:06:41

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/fe8715961711d (https://tezfiles.com/file/fe8715961711d)

Tiered
01-18-2022, 01:23 AM
Clubdom.com- The Pony
https://img165.imagetwist.com/th/44670/aelcjcshlyot.jpg (https://imagetwist.com/aelcjcshlyot/the_.jpg)
https://img119.imagetwist.com/th/44670/6my01b9x2oou.jpg (https://imagetwist.com/6my01b9x2oou/the_.mp4.jpg)

Description:
Pony Boy Cameron will be the Mistress_s transportation today. The Mistress_s demand him to ride them around there estate. The Mistress_s demand he be a good pony and go fast. The Mistress_s decide to take a pit stop so the slave can worship there boots. After the Mistress_s boots are nice and clean its back to work for the slave. The Mistress_s allow the slave to go but not before he cums in a spoon and eat it.
Model:
Pony Play
Studio:
Clubdom.com
Info:
File Name : thepony.mp4
File Size : 201.62 MB
Resolution : 640x360
Duration : 00:08:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4e8d5c576a8cd (https://tezfiles.com/file/4e8d5c576a8cd)

Tiered
01-18-2022, 01:30 AM
Clubdom.com- Michelle Lacy Lydia Supremacy
https://img165.imagetwist.com/th/44830/6iv4mze7r0c6.jpg (https://imagetwist.com/6iv4mze7r0c6/s699michellelacylydiasupremicypov.jpg)
https://img119.imagetwist.com/th/44830/r8idfffgdcy6.jpg (https://imagetwist.com/r8idfffgdcy6/mTEIzM.jpg)

Description:
Goddess Lydia Supremacy and Mistress Michelle Lacy have their slave on his knees where he belongs making this pathetic bitch stroke his tiny pathetic man clit, His penis is so small they have renamed it Dicklet. The women are mean and cruel making him use his thumb and index finger to stroke his little slut stick Laughing and counting him down from 10 then letting hi, dribble his tiny drops of man filth all over the floor and then making him lick it up.
Model:
Lydia Supremacy, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s699michellelacylydiasupremicypov.mp4
File Size : 360.21 MB
Resolution : 1280x720
Duration : 00:07:38

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/7d30443f83bc2 (https://tezfiles.com/file/7d30443f83bc2)

Tiered
01-18-2022, 01:36 AM
Clubdom.com- Crops a Slave_s Cock And Ass
https://img119.imagetwist.com/th/45086/h5jz17s4bbyz.jpg (https://imagetwist.com/h5jz17s4bbyz/BxuqwJk.jpg)
https://img202.imagetwist.com/th/45086/m3le94uuqt6p.jpg (https://imagetwist.com/m3le94uuqt6p/vIHwTikJ.jpg)

Description:
Domina Snow crops a slave_s cock, ass and backside.
Model:
Domina Alexandra Snow
Studio:
Clubdom.com
Info:
File Name : Movie323.wmv
File Size : 13.47 MB
Resolution : 320x240
Duration : 00:03:38

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/9922c049fcf78 (https://tezfiles.com/file/9922c049fcf78)

Tiered
01-18-2022, 01:46 AM
Clubdom.com- Demands The Slave Maintain Good Composure
https://img119.imagetwist.com/th/45169/dvphvjdx4gae.jpg (https://imagetwist.com/dvphvjdx4gae/fpXueO.jpg)
https://img119.imagetwist.com/th/45169/bybgq7pc46no.jpg (https://imagetwist.com/bybgq7pc46no/iekIJAZX.jpg)

Description:
Lady Cheyenne releases the slave_s balls and demands the slave maintain good composure as she gives him 10 more lashes with a quirt
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie315.wmv
File Size : 9.36 MB
Resolution : 320x240
Duration : 00:02:31

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6d12e2a9a06c8 (https://tezfiles.com/file/6d12e2a9a06c8)

Tiered
01-18-2022, 01:47 AM
Clubdom.com- Cum Like A Man Or Lose Your Balls
https://img119.imagetwist.com/th/44714/25bmy4igl5mq.jpg (https://imagetwist.com/25bmy4igl5mq/cumlikeamanorloseyourballs.jpg)
https://img202.imagetwist.com/th/44714/83aj097o4s7l.jpg (https://imagetwist.com/83aj097o4s7l/cumlikeamanorloseyourballs.mp4.jpg)

Description:
The Mistress walk into a bound slave with a hard cock. The Mistress_s have ball cutters and threaten to cut his pathetic balls off. The Mistress_s think they should just cut off his balls now but decide to see if he can produce some cum first. The Mistress_s let the slave now if he does not give them a real mans load those balls will be cut off. Mistress Mia Boss and Mistress Elena take turns stroking his loser cock while constantly threatening to cut off his useless balls. The Mistress torture his balls while stroking his cock to make this handjob unenjoyable. The Mistress force him to spill his load. The Mistress are disappointed so they decide to keep his balls by cutting them off
Model:
Elena Sin, Mia Martinez
Studio:
Clubdom.com
Info:
File Name : cumlikeamanorloseyourballs.mp4
File Size : 142.34 MB
Resolution : 640x360
Duration : 00:06:23

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/efb360b1603e0 (https://tezfiles.com/file/efb360b1603e0)

Tiered
01-18-2022, 02:04 AM
Clubdom.com- Whipped By Cruel Women
https://img119.imagetwist.com/th/45072/v7h3xw9b4vmd.jpg (https://imagetwist.com/v7h3xw9b4vmd/cd_s1230_meganjones_miaannabella_whipping.jpg)
https://img119.imagetwist.com/th/45072/2gdzm0h9168j.jpg (https://imagetwist.com/2gdzm0h9168j/rSoNRMw.jpg)

Description:
Megan Jones and Mia Annabella are vicious sadists who are bent on breaking this slave purely for fun. They pretended that he didn_t do the best job cleaning, just to have an excuse to hurt him for their enjoyment. They string him up and Mistress Megan whips him good with Mia assisting in the torment. The women love being so cruel. Are you next?
Model:
Megan Jones
Studio:
Clubdom.com
Info:
File Name : cd_s1230_meganjones_miaannabella_whipping.mp4
File Size : 321.32 MB
Resolution : 1280x720
Duration : 00:06:47

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b390965594e90 (https://tezfiles.com/file/b390965594e90)

Tiered
01-18-2022, 02:07 AM
Clubdom.com- Michelle and Tangent_s Auction Slave 8: Duel Canings
https://img119.imagetwist.com/th/45050/jwldnmlw3jx8.jpg (https://imagetwist.com/jwldnmlw3jx8/cd_s992_8-8_michellelacy_goddesstangent_caning.jpg)
https://img202.imagetwist.com/th/45050/zwnp4oqx7ou5.jpg (https://imagetwist.com/zwnp4oqx7ou5/BLxiADuS.jpg)

Description:
The new auction slave and the seasoned Clubdom slave are bent over and restrained. They await their painful fate as Michelle Lacy and Goddess Tangent discuss how hard they are going to cane each man. Their auction slave is most likely going back to the slave farm but they want to cane him anyway. Perhaps he might show some glimmer of hope. The two Mistresses cane both slaves. With heavy lightening fast blows, the hits keep coming. The more the women hit them, the more sadistic and happy they become. The two men are definitely in intense pain but the auction slave just trembles and cries for mercy. These women are not having it. Back to the slave farm he goes but they need to punish the head slaver who sold him to them. Paris announces that he has arrived and the women grab him. Tangent face slaps him and kicks him in the balls while Michelle holds him. They scold the slaver and tell him he is to take back that pathetic excuse for a slave and to never sell them such a sorry excuse of a man ever again.
Model:
Goddess Tangent, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s992_8-8_michellelacy_goddesstangent_caning.mp4
File Size : 352.95 MB
Resolution : 1280x720
Duration : 00:07:31

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4503a53355c68 (https://tezfiles.com/file/4503a53355c68)

Tiered
01-18-2022, 02:09 AM
Clubdom.com- Dava Foxx Kylie Whipping
https://img119.imagetwist.com/th/44827/4yu3qlmfp7pf.jpg (https://imagetwist.com/4yu3qlmfp7pf/s670davakyliewhipping.jpg)
https://img119.imagetwist.com/th/44827/zs1e0tuiopcr.jpg (https://imagetwist.com/zs1e0tuiopcr/UPRFVfy.jpg)

Description:
Bratty Doms Dava Foxx and Kylie Rogue decide it_s time to whip their bitch. They pull the pathetic slave from his cage and tell him they can_t decide whether they want to cane him or whip him. Goddess Kylie says how about we whip him till he begs us to cane him. Strapping the bitch on the iron cross and they take turns whipping the slaves back. Making him beg to be caned. The women spare no mercy demanding him to thank them. Goddess Dava runs her sharp nails down the slaves back as he screams and the ladies laugh.
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s670davakyliewhipping.mp4
File Size : 404.02 MB
Resolution : 1280x720
Duration : 00:08:33

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c07b495c8f504 (https://tezfiles.com/file/c07b495c8f504)

Tiered
01-18-2022, 02:14 AM
Clubdom.com- Bratty Doms Cuck and Fuck You
https://img119.imagetwist.com/th/45070/p0vikyx50tbq.jpg (https://imagetwist.com/p0vikyx50tbq/cd_s643_full_mena_li_racheal_madori.jpg)
https://img202.imagetwist.com/th/45070/ny5xs7o1vszz.jpg (https://imagetwist.com/ny5xs7o1vszz/inAEqKuV.jpg)

Description:
Goddesses Mena Li and Rachael Madori have a surprise for their college boys Bradley and Alex. The boys think they_re going to get lucky, but the Goddesses have other plans for them. When the girls arrive at their house Bradley and Alex are in complete shock when they see what they are wearing. Goddess Mena and Goddess Rachael lead the boys into the house. The guys get them drinks and try to get a little frisky, But before they can even get their arm around them, they are shoved down to their knees, They are told the only way you will please us is by using these chindos. The Goddess_s strap up the cuck boy_s face_s and tell them fuck us until we cum, show us that you_re worthy. If you ever want to get this pussy, you_ll do what we say. The boys comply after the ladies have their orgasms, Goddess Mena yells You will be our fuck toys from now on. Goddess Mena Strokes Alex_s pathetic dick, while Goddess Rachael moans in ecstasy from making him eat her pussy, The Goddess_s switch places, finally giving him permission to spill his disgusting filth, They feed it to him. now that Alex has proved to Goddess Rachael Madori and Mena Li that he was worthy by guzzling his own cum, he calls out looking for his friend Bradley. So the Girls call him from the kitchen pantry dressed in latex, where he has been locked away for at least an hour. Forcing their slaves to deep throat their 12 black cocks before fucking them up the ass. These gagging, drooling fuck toys really had no clue what was in store for them. Goddess Rachael Bends her slut over and fucks his tight man pussy, The boys are crying and begging for them to stop. Lets just say Alex was not expecting to be getting fucked next to his best friend with a 12 strap-on today.
Model:
Mena Li, Mistress Rachael
Studio:
Clubdom.com
Info:
File Name : cd_s643_full_mena_li_racheal_madori.mp4
File Size : 962.27 MB
Resolution : 1280x720
Duration : 00:20:18

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1a8f38c974e43 (https://tezfiles.com/file/1a8f38c974e43)

Tiered
01-18-2022, 02:20 AM
Clubdom.com- Destroy his nuts
https://img119.imagetwist.com/th/45176/hib0pqwnsrxc.jpg (https://imagetwist.com/hib0pqwnsrxc/movie959cfs.jpg)
https://img202.imagetwist.com/th/45176/1hxghn07bsgg.jpg (https://imagetwist.com/1hxghn07bsgg/gZjNRP.jpg)

Description:
Cheyenne has instructed her bitch to build the ultimate cbt device and be locked into it when she arrives. The slut has been waiting nervously awaiting her arrival when he hears the click of her high heels coming across the floor. Beads of sweat break out on the slut_s face. There is no turning back now. Cheyenne picks up his balls and squeezes them tightly. She tells the bitch that she will destroy his balls. Then Cheyenne lays into his helpless nuts with a single tail whip, producing instant welts and bruises. Oh, she loves it The bitch knows that Cheyenne will not be stopping any time soon. Cheyenne picks up a cane and delivers cruel strokes to the slut_s helpless nuts. What do you need these for anyway? She laughs, caning the slut_s aching nuts even more. The slut_s suffering only feeds Cheyenne_s sadistic streak and increases her desire to destroy his nuts. Cheyenne picks up the whip again and beats the slut_s balls until he cries. Then she laughs and gives his freshly destroyed balls and good squeeze.
Model:
Caning, CBT
Studio:
Clubdom.com
Info:
File Name : Movie959CFS.wmv
File Size : 71.21 MB
Resolution : 720x480 @ 810x480
Duration : 00:06:13

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c59ec8fb1352f (https://tezfiles.com/file/c59ec8fb1352f)

Tiered
01-18-2022, 02:21 AM
Clubdom.com- Dava Foxx Gets Pleasured by Chindo
https://img69.imagetwist.com/th/44836/mbdv6vrdrybn.jpg (https://imagetwist.com/mbdv6vrdrybn/s860davafoxxchindo.jpg)
https://img69.imagetwist.com/th/44836/r6uoc4fgvw2y.jpg (https://imagetwist.com/r6uoc4fgvw2y/xvGCBsQ.jpg)

Description:
Goddess Dava Foxx has her slave on his knees lubing up her hard 14 inch cock getting it ready to shove up your ass, she knows what an anal whore you are and plans on giving you the pounding of your pathetic slutty life, She goes deep and hard fuck you till she gets off, Then kicks you in the ass all the way back to the stable.
Model:
Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s860davafoxxchindo.mp4
File Size : 349.37 MB
Resolution : 1280x720
Duration : 00:07:23

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f4bb852bdaf37 (https://tezfiles.com/file/f4bb852bdaf37)

Tiered
01-18-2022, 02:23 AM
Clubdom.com- Lexi Kelly Boot Jerk
https://img202.imagetwist.com/th/45049/0r0kb56v2wyt.jpg (https://imagetwist.com/0r0kb56v2wyt/cd_s993_lexiluna_kellypaige_bootjerk.jpg)
https://img119.imagetwist.com/th/45049/w2dayu6wbhky.jpg (https://imagetwist.com/w2dayu6wbhky/GJHvdnOz.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Kelly Paige, Lexi Luna
Studio:
Clubdom.com
Info:
File Name : cd_s993_lexiluna_kellypaige_bootjerk.mp4
File Size : 260.07 MB
Resolution : 1280x720
Duration : 00:05:32

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a702648b831c9 (https://tezfiles.com/file/a702648b831c9)

Tiered
01-18-2022, 02:27 AM
Clubdom.com- Kicked Before And After Cumming
https://img202.imagetwist.com/th/45182/3vrnwwndslzb.jpg (https://imagetwist.com/3vrnwwndslzb/xBMcPGm.jpg)
https://img119.imagetwist.com/th/45182/r30te5rgvw83.jpg (https://imagetwist.com/r30te5rgvw83/KfqSPxs.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie599.wmv
File Size : 14.17 MB
Resolution : 320x240
Duration : 00:03:49

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/7af64f167e8ef (https://tezfiles.com/file/7af64f167e8ef)

Tiered
01-18-2022, 02:28 AM
Clubdom.com- Milking Your Slutty Balls (Edging)
https://img119.imagetwist.com/th/44824/nm89538yw4aa.jpg (https://imagetwist.com/nm89538yw4aa/s608kylieroguejamievalentinemilking.jpg)
https://img119.imagetwist.com/th/44824/nedr86cck7pd.jpg (https://imagetwist.com/nedr86cck7pd/wLXAIR.jpg)

Description:
Goddess Jamie Valentine and Mistress Kylie Rogue decide it_s time to drain another bitches _ sacks of every bit of man filth. The bitch is milked hard and fast. The ladies are demanding that he produces a huge load because it will be the only nourishment the slut gets for weeks. They edge him right to the brink and then laugh as he sprays squirt after squirt his thick white milky man goo all over Goddess Jamie_s black glove. He is then feed every last drop. See you again in thirty days bitch
Model:
Jamie Valentine, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : s608kylieroguejamievalentinemilking.mp4
File Size : 377.59 MB
Resolution : 1280x720
Duration : 00:08:00

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/874e2a89bcfb1 (https://tezfiles.com/file/874e2a89bcfb1)

Tiered
01-18-2022, 02:49 AM
Clubdom.com- Bare Foot in the Garden
https://img202.imagetwist.com/th/45172/cjab7lte5s7c.jpg (https://imagetwist.com/cjab7lte5s7c/movie316cfs.jpg)
https://img202.imagetwist.com/th/45172/avlxu9qccqxe.jpg (https://imagetwist.com/avlxu9qccqxe/tBwXbc.jpg)

Description:
Cheyenne is working in her flower garden. She notices her house slave watching her from the window. She pretends not to notice but begins teasing him flashing her high arches, digging her toes into the dirt and wiggling her lovely toes in the sprinkler. Then she rings the door bell and waits for her servant to answer. Cheyenne demands he fall to his knees and lick her feet clean. She doesn_t want dirt tracked in on her clean floors. As she shoves her foot down her slave_s throat she tells him that for rest of the summer, he_ll be on stand by as her door mat. Every time her door bell rings, he best be on his knees with his tongue out. After all, Cheyenne laughs, You are just a foot fag, thrilled to put your mouth on such a soft pink part of my body.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie316cfs.mp4
File Size : 81.23 MB
Resolution : 640x480
Duration : 00:06:55

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/00d9f336490a9 (https://tezfiles.com/file/00d9f336490a9)

Tiered
01-18-2022, 02:53 AM
Clubdom.com- Cock attention
https://img119.imagetwist.com/th/45176/ci14hdfd14l6.jpg (https://imagetwist.com/ci14hdfd14l6/movie980cfs.jpg)
https://img119.imagetwist.com/th/45176/nt1usmb9n8f2.jpg (https://imagetwist.com/nt1usmb9n8f2/sHHGcxz.jpg)

Description:
Lady Cheyenne leads her male bitch in by his cock. She restrains him to an x frame, puts his balls in a humbler and proceeds to whip and crop the bitch_s cock and balls. She lays into his helpless balls with a single tail and then takes a riding crop to his cock. Cheyenne smiles as the bitch_s balls turn purple. Then she releases the bitch_s aching balls from the humbler, squeezes them so tightly in her hand they look as if they will burst and drives her finger into them. Cheyenne enjoys giving her male _ a little cock attention.
Model:
Ball Busting, CBT
Studio:
Clubdom.com
Info:
File Name : Movie980CFS.wmv
File Size : 61.58 MB
Resolution : 720x480 @ 810x480
Duration : 00:05:25

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a86958479ef9f (https://tezfiles.com/file/a86958479ef9f)

Tiered
01-18-2022, 03:01 AM
Clubdom.com- Abusive Whipping
https://img119.imagetwist.com/th/44715/pvvzge7pwv59.jpg (https://imagetwist.com/pvvzge7pwv59/abusivewhipping.jpg)
https://img119.imagetwist.com/th/44715/05609ub0of0h.jpg (https://imagetwist.com/05609ub0of0h/abusivewhipping.mp4.jpg)

Description:
Goddess Amadahy And Mia are out to inflict pain and abuse this poor soul. The Mistress want pain and anguish from this pathetic slave. The Mistress pain his back with one slash after another. The slave will do anything for his Mistress_s even if it takes taking a beating of a lifetime. The slave is left with welts on his back and scars for life.
Model:
Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : abusivewhipping.mp4
File Size : 143.51 MB
Resolution : 640x360
Duration : 00:06:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/27fc2b2031a83 (https://tezfiles.com/file/27fc2b2031a83)

Tiered
01-18-2022, 03:02 AM
Clubdom.com- Russian Revenge Part 1
https://img202.imagetwist.com/th/45069/c8nulo8bcr4e.jpg (https://imagetwist.com/c8nulo8bcr4e/cd_s673_1-2_russianrevenge.jpg)
https://img202.imagetwist.com/th/45069/z43s6xbkjoyi.jpg (https://imagetwist.com/z43s6xbkjoyi/MiqkONW.jpg)

Description:
Dava is a sweet girl who met Cameron at a local night club. She thought he was really sweet and really liked him. He told her that she was different and that he had feelings for her. After a little bit of kissing one thing led to another. To Dava, the sex was not that great but she really likes this guy. He promises to call her the next day, however, after weeks he never returns her texts or phone calls. Cameron is a player and only out for hooks up and one night stands with no regard to any of the women_s emotions. Months go by and Dava_s Russian Aunt finds out what was done to her niece. She spots Cameron at a local hang out and uses her thick Russian accent and sexuality to lure Cameron for some fun. She is pulling Cameron into a barn in the middle of nowhere, blindfolded with his arms duck taped together. His clothes are all ripped and torn and throws him into the corner. So you like one night stands? I hear you like to do your thinking with that thing between your legs. Using women then never call and then have any regard for their feelings. I am going to show you what this feels like. Cameron is terrified asking what are you going to do to me Kylie grabs a drill and puts the bit right to his forehead and says maybe we should just put a hole here to correct the problem. But that_s not the head that you_re doing the thinking with now is it? The picks up an old rusty machete spreads his legs and swings the machete down within inches of his tiny little pathetic dicklet. He screams. Goddess Kylie calmly takes a drag of her cigarette. Slowly exhaling the smoke right in the bitches face. She then grabs him and tells him I have something much better for you. Leading him over to where her sister Dava is brandishing a 12 inch black strap on she informs him you are going to participate in one of your favorite activities. Open that bitch slut mouth and suck her cock Dominating him completely and shoving his face down on the cock till he gags they make him beg for Dava to fuck his pathetic man-pussy. (Pt 1 of 2) stay tuned ....
Model:
Dava Foxx, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : cd_s673_1-2_russianrevenge.mp4
File Size : 334.27 MB
Resolution : 1280x720
Duration : 00:07:02

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/8a05605be8b54 (https://tezfiles.com/file/8a05605be8b54)

Tiered
01-18-2022, 03:09 AM
Clubdom.com- Jewel Amadahy Electric Ass Worship
https://img202.imagetwist.com/th/45055/ta19sg7565gx.jpg (https://imagetwist.com/ta19sg7565gx/cd_s505_cheyenne_jewel_amadahy_ass_lick.jpg)
https://img119.imagetwist.com/th/45055/zh19ed2m989j.jpg (https://imagetwist.com/zh19ed2m989j/OteklBpU.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Cheyenne Jewel, Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : cd_s505_cheyenne_jewel_amadahy_ass_lick.mp4
File Size : 330.96 MB
Resolution : 1280x720
Duration : 00:06:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/7f58d1d425964 (https://tezfiles.com/file/7f58d1d425964)

Tiered
01-18-2022, 03:30 AM
Clubdom.com- Dava Foxx Caning Humiliating Guy
https://img33.imagetwist.com/th/44829/rysex1yg6j3s.jpg (https://imagetwist.com/rysex1yg6j3s/s772davafoxxcaning.jpg)
https://img202.imagetwist.com/th/44829/2v7d9ivhr91c.jpg (https://imagetwist.com/2v7d9ivhr91c/HWjwtgaV.jpg)

Description:
Goddess Dava Foxx is in a mean sadistic mood today and bound with his hands behind his back and attached to the suspension device, Not happy with the _ progress today in his ball stretching exercise, She measures and says they are still not stretched enough so she canes him first with her yardstick, then pulls out a rattan cane and proceeds to cane the living hell out of him, Laughing the whole time telling him that this is what makes his Goddess_s pussy wet, She even sticks the tip of the cane in her black g string and holds it under the slut nose just to torment him even more, She tells him that is the smell of happiness for his suffering.
Model:
Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s772davafoxxcaning.mp4
File Size : 336.41 MB
Resolution : 1280x720
Duration : 00:07:08

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ba6b250099c18 (https://tezfiles.com/file/ba6b250099c18)

Tiered
01-18-2022, 03:37 AM
Clubdom.com- Jerk it or Lose It
https://img202.imagetwist.com/th/45068/qdcp6yrq2l08.jpg (https://imagetwist.com/qdcp6yrq2l08/cd_s1138_nadiawhite_nyssanevers_pov.jpg)
https://img202.imagetwist.com/th/45069/m0dm78p4uvx9.jpg (https://imagetwist.com/m0dm78p4uvx9/McHVdvvf.jpg)

Description:
Goddess Nadia White and Goddess Nyssa Nevers are standing in front of you dressed in latex dresses and black boots wondering what you could possibly do with that tiny disgusting dick. The Goddesses can only imagine any woman throwing up if that dicklette got near them. They know that you are a virgin, and have never used your little tiny dicklette. Goddess Nyssa Never almost feels bad for you for having such a small worthless prick, but she doesn_t give a shit about you.
Model:
Nadia White, Nyssa Nevers
Studio:
Clubdom.com
Info:
File Name : cd_s1138_nadiawhite_nyssanevers_pov.mp4
File Size : 287.12 MB
Resolution : 1280x720
Duration : 00:06:05

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/23d9c90f3ee10 (https://tezfiles.com/file/23d9c90f3ee10)

Tiered
01-18-2022, 03:49 AM
Clubdom.com- Pilates Boy Gets Ass Fucked Part 3
https://img69.imagetwist.com/th/44822/7u9ty7f1g5fg.jpg (https://imagetwist.com/7u9ty7f1g5fg/s497_minimovie_stevie_shae_kelly_diamond_part3.jpg )
https://img202.imagetwist.com/th/44822/rnppqcnp2ild.jpg (https://imagetwist.com/rnppqcnp2ild/fVWBJen.jpg)

Description:
Stevie Shay and Kelly Diamond are ruthless when it comes to humiliating men. The ladies have just beaten up a self proclaimed tough guy and have now decided to take him with their strap on cocks. Oh, the joy of emasculation Stevie and Kelly are simply glowing as they nail this bitch_s fuck hole. Kelly is preparing to pile drive the male slut, one of his friends walks up. He is shocked. How can a real man let women do this to him? Stevie laughs. Without hesitation, she smacks the friend in the face, throws him down on the wrestling matt and starts fucking his man pussy As Stevie and Kelly pile drive the bitches in unison they smile at each other, having ridden the world of two inflated male egos.
Model:
Kelly Diamond, Stevie Shae
Studio:
Clubdom.com
Info:
File Name : s497_minimovie_stevie_shae_kelly_diamond_part3.mp4
File Size : 314.47 MB
Resolution : 1280x720
Duration : 00:06:41

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2c56df85bb5d6 (https://tezfiles.com/file/2c56df85bb5d6)

Tiered
01-18-2022, 03:51 AM
Clubdom.com- Milking Day for Bitch 067
https://img119.imagetwist.com/th/45076/2xag54bygn3z.jpg (https://imagetwist.com/2xag54bygn3z/cd_s1255_kendrajames_hadleyvascara_milking.jpg)
https://img119.imagetwist.com/th/45076/zssvlob79rvv.jpg (https://imagetwist.com/zssvlob79rvv/DLFjtAM.jpg)

Description:
Mistress Kendra and Mistress Hadley Viscara are going to milk bitch 067. Their slave hasn_t been milked in a very long time and needs to get his slut-sack drained. The women have him bound and unable to get away as they playfully but sadistically drain his pathetic balls. The women aren_t going to make it easy on him, and he needs to comply with their demands. Finally his filth is drained and fed to him.
Model:
Hadley Viscara, Kendra James
Studio:
Clubdom.com
Info:
File Name : cd_s1255_kendrajames_hadleyvascara_milking.mp4
File Size : 368.07 MB
Resolution : 1280x720
Duration : 00:07:45

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ff4741f5df620 (https://tezfiles.com/file/ff4741f5df620)

Tiered
01-18-2022, 03:55 AM
Clubdom.com- Mistress Dahlia Whips Her Pony Bitch
https://img119.imagetwist.com/th/45185/ltja7czze3o0.jpg (https://imagetwist.com/ltja7czze3o0/cd_s1384_dahliarain_whipping.jpg)
https://img119.imagetwist.com/th/45185/8536yfbv9umq.jpg (https://imagetwist.com/8536yfbv9umq/ViBBmNo.jpg)

Description:
Mistress Dahlia Rain now has her pony slave bound to one of the whipping posts outside. Dahlia has been waiting for this all day Her slave dances from the strokes that Mistress Dahlia administers to him. He can cry, dance, beg and plead all that he wants. But he cant escape and no one will save him out here Mistress Dahlia sadistically and mercilessly continues the slaves beating. Mistress Dahlia takes a break to admire the red striped artwork that she created on her slaves back. She is delighted with the welts that are on her canvas, she rubs her hands down his back feeling the texture. After Dahlia is done with her punishment she walks over to her bitch and pinches his nipples, making him scream. She tells her bitch that he has had enough of her whip for the day. Mistress Dahlia decides that she isnt done with her pony yet and orders him to pull her in the pony cart back to the dungeon
Model:
Dahlia Rain
Studio:
Clubdom.com
Info:
File Name : cd_s1384_dahliarain_whipping.mp4
File Size : 304.55 MB
Resolution : 1280x720
Duration : 00:06:19

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e6a61d2270323 (https://tezfiles.com/file/e6a61d2270323)

Tiered
01-18-2022, 03:59 AM
Clubdom.com- Tormenting the Chastity Slave
https://img119.imagetwist.com/th/44721/itw5t1abi5e5.jpg (https://imagetwist.com/itw5t1abi5e5/ggcd.jpg)
https://img202.imagetwist.com/th/44721/tu42stnvqy8k.jpg (https://imagetwist.com/tu42stnvqy8k/ggcd.mp4.jpg)

Description:
Sasha Meow and Goddess Esmi are in the mood for a little fun. They have their chastity slave tied to a bed. It has been over 30 days since the bitch has been allowed to orgasm. The ladies are amused by his frustration. As they begin to tease the slut_s caged up cock they start getting turned on. Esmi and Sasha pleasure each other, having multiple orgasms while the helpless slave can have none. Maybe next month the ladies will feel more generous. As for now, the slave will be sent back to his cage, more desperate and horny than ever.
Model:
Esmi Lee, Sasha Meow
Studio:
Clubdom.com
Info:
File Name : ggcd.mp4
File Size : 233.52 MB
Resolution : 640x360
Duration : 00:07:34

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/7426dd562d9a7 (https://tezfiles.com/file/7426dd562d9a7)

Tiered
01-18-2022, 04:12 AM
Clubdom.com- Ash Cleaning Boot Faggot
https://img202.imagetwist.com/th/44662/2w9jamrujqnu.jpg (https://imagetwist.com/2w9jamrujqnu/cd_03_10_13_bootworship.jpg)
https://img165.imagetwist.com/th/44662/m4v3o1xv2byh.jpg (https://imagetwist.com/m4v3o1xv2byh/cd_03_10_13_bootworship.mp4.jpg)

Description:
Goddess Amadahy and Mistress Vendetta are relaxing after a long day of dominating their slaves and decide to have their boots cleaned while they enjoy smoking their cigarettes. They summon one of the stable boot faggots to light their cigarettes and then use him as an ashtray while he is cleaning their boots.

When the bitch proves to be an incompetent ashtray, dropping ashes and spit onto the floor, Amadahy grabs his head and makes him into a human mop, cleaning up the mess off of the floor, then puts him back on boot cleaning detail. The Mistreses then wipe the filth from the bottoms of their boots all over his blackened tongue and face. When Amadahy has finished with her cigarette, she heartlessly puts it out on his tongue, then tells him how pathetic she thinks he really is.
Model:
Goddess Amadahy, Venus Divine
Studio:
Clubdom.com
Info:
File Name : cd_03_10_13_bootworship.mp4
File Size : 302.57 MB
Resolution : 1280x720
Duration : 00:06:25

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ac15a6ba578d8 (https://tezfiles.com/file/ac15a6ba578d8)

Tiered
01-18-2022, 04:24 AM
Clubdom.com- Hope Harper Marsha May Caning
https://img69.imagetwist.com/th/44827/5lr5gqc2d3vy.jpg (https://imagetwist.com/5lr5gqc2d3vy/s716hopeharpermarshamaycaining.jpg)
https://img202.imagetwist.com/th/44827/b9noks0rdjad.jpg (https://imagetwist.com/b9noks0rdjad/CcWDowbs.jpg)

Description:
Goddess Marsha May and Hope Harper like beating their bitch. Goddess Hope walks her dog out on a leash and presents him to Goddess Marsha. They bend their bitch over the stock and unleash a brutal sadistic caning. Goddess Marsha even straddles her bitch as she canes his ass even harder making him beg for every stroke. After they are through they feel it_s time to play a little game of fetch. They throw their canes out into the yard allowing the bitch slave to run out and retrieve them.
Model:
Hope Harper, Marsha May
Studio:
Clubdom.com
Info:
File Name : s716hopeharpermarshamaycaining.mp4
File Size : 401.53 MB
Resolution : 1280x720
Duration : 00:08:16

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1e747956adb8a (https://tezfiles.com/file/1e747956adb8a)

Tiered
01-18-2022, 04:25 AM
Clubdom.com- Punishing the Runaway Slave
https://img202.imagetwist.com/th/45067/wzz9qu4v0qi9.jpg (https://imagetwist.com/wzz9qu4v0qi9/cd_s1150_1-3_goddessdahlia_mistresstangent_ballbusting.jpg)
https://img119.imagetwist.com/th/45067/0kkoqg9z5h5u.jpg (https://imagetwist.com/0kkoqg9z5h5u/ClBlXZ.jpg)

Description:
Goddess Dahlia Rain and Mistress Tangent are outside in the beautiful weather enjoying a smoke trying to decide how they will abuse their slaves today, when one of the slaves takes advantage of the opportunity and attempts to escape. Of course Goddess Dahlia Rain and Mistress Tangent quickly catch the miserable pathetic slave. Goddess Dahlia holds him up with Mistress Tangent begins busting his worthless balls with her boot covered foot. Mistress Tangent asks if they are sore yet, then Goddess Dahlia begins kicking his disgusting slut sacks. Their slave collapses to the ground as he gets his balls tortured. They then force their slave to guess which Goddess is kicking his disgusting balls, or face more ball torture
Model:
Dahlia Rain, Goddess Tangent
Studio:
Clubdom.com
Info:
File Name : cd_s1150_1-3_goddessdahlia_mistresstangent_ballbusting.mp4
File Size : 343.71 MB
Resolution : 1280x720
Duration : 00:07:18

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/283f1cea02efd (https://tezfiles.com/file/283f1cea02efd)

Tiered
01-18-2022, 04:40 AM
Clubdom.com- Suck Our Strap Ons POV
https://img33.imagetwist.com/th/44823/iz58g1f210zb.jpg (https://imagetwist.com/iz58g1f210zb/s586michellelacybriannapov.jpg)
https://img119.imagetwist.com/th/44823/mv2awf2m7ne9.jpg (https://imagetwist.com/mv2awf2m7ne9/RIMhGz.jpg)

Description:
Mistress Michelle Lacy and Goddess Brianna know that you wish you could have a huge strap on shoved down your pathetic fuck hole. That all you dream about is lubing up their big 12 inch cocks so you could be fucked with your own spit in your tight little pussy hole. The ladies instruct you how they want you to masturbate with your thumb and your index finger stroking your little tiny pathetic dicklett while shoving a huge black dildo up your ass while staring at their black shiny boots. Just wishing you could be controlled and fucked like the little pussy that you are. They edge you and your little pathetic 2 inch dick right to the point of cumming. As they are laughing you are made to shove two, then three fingers up your asshole. As you finger your asshole you are then allowed to spill your filth. But there is a catch. They will be making you lick up every last drop bitch.
Model:
Goddess Brianna, Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : s586michellelacybriannapov.mp4
File Size : 244.89 MB
Resolution : 1280x720
Duration : 00:05:10

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/28e0b90d9fa48 (https://tezfiles.com/file/28e0b90d9fa48)

Tiered
01-18-2022, 04:47 AM
Clubdom.com- Trained to Lick Ass
https://img202.imagetwist.com/th/44721/cmqldnpq03d0.jpg (https://imagetwist.com/cmqldnpq03d0/assworship.jpg)
https://img119.imagetwist.com/th/44721/ykzuk9jz3hw9.jpg (https://imagetwist.com/ykzuk9jz3hw9/assworship.mp4.jpg)

Description:
Sasha Meow and Goddess Esmi lead their slaves out in fiddles. They inspect each slave one by one until deciding which bitch they will use to worship their asses. Sasha learns that one of the male bitches has never worshiped ass before. She is amused. The male bitch is put on his knees and a shock collar secured to his balls. He is made to worship Esmi_s ass as Sasha shocks his worthless balls. Esmi smiles as the slave struggles to get his tongue deep inside her beautiful asshole.
Model:
Esmi Lee, Sasha Meow
Studio:
Clubdom.com
Info:
File Name : assworship.mp4
File Size : 213.54 MB
Resolution : 640x360
Duration : 00:06:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c75ee5f08c78f (https://tezfiles.com/file/c75ee5f08c78f)

Tiered
01-18-2022, 04:56 AM
Clubdom.com- Beating Her Meat With a Cane
https://img202.imagetwist.com/th/45069/1vvfpnfiz4tp.jpg (https://imagetwist.com/1vvfpnfiz4tp/cd_s1190_nadiawhite_caning.jpg)
https://img202.imagetwist.com/th/45069/goy9l1cwekvs.jpg (https://imagetwist.com/goy9l1cwekvs/JEnmUBE.jpg)

Description:
Goddess Nadia White drags a slave out to the middle of her dungeon where she asks him a very simple question Does he like to beat his meat? What a coincidence Goddess Nadia White likes to beat her meat as well. Goddess Nadia bends him over the whipping horse where she starts to tenderize his pale white ass by administrating a caning. Goddess Nadia wants her slave to count each caning stroke she administers. Goddess Nadia gives him 10 loving swats with her cane before having him count them down from 10.
Model:
Nadia White
Studio:
Clubdom.com
Info:
File Name : cd_s1190_nadiawhite_caning.mp4
File Size : 316.13 MB
Resolution : 1280x720
Duration : 00:06:42

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/81bdf06e4d4e8 (https://tezfiles.com/file/81bdf06e4d4e8)

Tiered
01-18-2022, 04:59 AM
Clubdom.com- Worship Alexa_s Ass Bitch‏
https://img69.imagetwist.com/th/44822/sjsxkwtn8glb.jpg (https://imagetwist.com/sjsxkwtn8glb/s519_kendra_esmi_alexa_rydel_ass_lick.jpg)
https://img69.imagetwist.com/th/44822/p5k3sbte8f0c.jpg (https://imagetwist.com/p5k3sbte8f0c/uyyYtYts.jpg)

Description:
Mistress Alexa Rydel loves to have her ass cleaned and worshiped by her slaves. She demands they clean and lick her beautiful ass hole to perfection. In this explicit clip, Mistress Alexa puts her slave to the test and enjoys every moment of his servitude as her slave_s breath, clean and worship her lovely ass.
Model:
Alexa Rydell
Studio:
Clubdom.com
Info:
File Name : s519_kendra_esmi_alexa_rydel_ass_lick.mp4
File Size : 253.48 MB
Resolution : 1280x720
Duration : 00:05:22

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c14cd6b2f419a (https://tezfiles.com/file/c14cd6b2f419a)

Tiered
01-18-2022, 05:12 AM
Clubdom.com- Mistress Lacy_s Tormenting Skills
https://img119.imagetwist.com/th/44720/d6anuwl7i9mf.jpg (https://imagetwist.com/d6anuwl7i9mf/mistresslacystormentingskills.jpg)
https://img202.imagetwist.com/th/44720/9ybddbm6nvc1.jpg (https://imagetwist.com/9ybddbm6nvc1/mistresslacystormentingskills.mp4.jpg)

Description:
Mistress Lacy_s well trained slave is in the cage behind her. Mistress Lacy explains she has has been tormenting this loser for 5 years. Mistress Lacy explains her dominance over men and her skills at training slaves. Mistress Lacy lets you know what she does to slaves as she puffs on her cigarettes. Mistress Lacy rips her slaves assholes with her big black strap-on cocks. Mistress Lacy all rips apart her slaves flesh with whips and canes. Mistress Lacy doesn_t have an astray for her cigarette she puffs on but she make you one. Mistress Lacy continues to let you konw just how evil she can be then puts out her cigarette. Mistress Lacy steps on the butt then gets back to tormenting her caged slave.
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : mistresslacystormentingskills.mp4
File Size : 154.16 MB
Resolution : 640x360
Duration : 00:05:01

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/704ffeeddb105 (https://tezfiles.com/file/704ffeeddb105)

Tiered
01-18-2022, 05:12 AM
Clubdom.com- Jean Bardot_s Ball Jug Training
https://img119.imagetwist.com/th/45076/o6sah1aolqen.jpg (https://imagetwist.com/o6sah1aolqen/cd_s1259_jeanbardot_cbt.jpg)
https://img202.imagetwist.com/th/45076/plq5yeb74x1n.jpg (https://imagetwist.com/plq5yeb74x1n/QDKfux.jpg)

Description:
Jean Bardot wants her slave to be able to take a lot of pain on his balls. She knows this won_t be easy and that is half the fun Jean attaches a lot of weight to his balls with a jog filled with water and makes him move around. Jean kicks the jug, laughing, knowing he is almost unable to handle it. The slave is in such pain, feeling he may pass out. Jean knows this and makes it even more difficult for him to take.
Model:
Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_s1259_jeanbardot_cbt.mp4
File Size : 257.56 MB
Resolution : 1280x720
Duration : 00:05:26

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/eeacdb5de93bd (https://tezfiles.com/file/eeacdb5de93bd)

Tiered
01-18-2022, 05:14 AM
Clubdom.com- Strap on Whore
https://img119.imagetwist.com/th/44736/lxlo0x9n6dnk.jpg (https://imagetwist.com/lxlo0x9n6dnk/straponwhore.jpg)
https://img202.imagetwist.com/th/44736/jagq2k4liu3a.jpg (https://imagetwist.com/jagq2k4liu3a/straponwhore.mp4.jpg)

Description:
Goddess Brianna and Mistress Kimylee have trained their strap on whore well. The enjoy making him beg for their dicks as they ass and face fuck him. The ladies have even found a new position in which they can drive their cocks deeper into his man pussy than ever before. The ladies completely own this bitch with their strap on dicks.
Model:
Goddess Brianna
Studio:
Clubdom.com
Info:
File Name : straponwhore.mp4
File Size : 210.09 MB
Resolution : 1280x720
Duration : 00:05:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a88a7463955f7 (https://tezfiles.com/file/a88a7463955f7)

Tiered
01-18-2022, 05:20 AM
Clubdom.com- Megan and Mistress Friend Whips Slave
https://img202.imagetwist.com/th/45166/ill8frbcgo8w.jpg (https://imagetwist.com/ill8frbcgo8w/cd_s178_meg_greg_whipping.jpg)
https://img119.imagetwist.com/th/45166/ppj9q0sh81v5.jpg (https://imagetwist.com/ppj9q0sh81v5/MrbbtWLk.jpg)

Description:
Never Released Megan Jones and her gorgeous friend Sophie decide that it_s time for a nice thorough whipping of their slave. They need to get the slave to the point where he is begging. Will he beg for them to stop? The women do not know but they want to find out and see.
Model:
Megan Jones
Studio:
Clubdom.com
Info:
File Name : cd_s178_meg_greg_whipping.mp4
File Size : 346.66 MB
Resolution : 1280x720
Duration : 00:07:16

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/000542c2eb384 (https://tezfiles.com/file/000542c2eb384)

Tiered
01-18-2022, 05:52 AM
Clubdom.com- A Milking to Remember
https://img69.imagetwist.com/th/44736/rdeg3w3zr8nx.jpg (https://imagetwist.com/rdeg3w3zr8nx/amilkingtoremember.jpg)
https://img69.imagetwist.com/th/44736/ut2b6mpvh7vs.jpg (https://imagetwist.com/ut2b6mpvh7vs/amilkingtoremember.mp4.jpg)

Description:
Kendra James and Goddess Charlyse drag a male bitch out and lock his balls in a humbler. It is milking day and the ladies are determined to achieve their goal without allowing the male bitch to enjoy the experience. Kendra and Charylse are quite rough with this slut, all the while extracting his male filth and offering him no enjoyment.
Model:
Kendra James
Studio:
Clubdom.com
Info:
File Name : amilkingtoremember.mp4
File Size : 248.06 MB
Resolution : 1280x720
Duration : 00:06:39

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/b47fd309997ac (https://tezfiles.com/file/b47fd309997ac)

Tiered
01-18-2022, 06:05 AM
Clubdom.com- Strap On
https://img119.imagetwist.com/th/45074/blo6m0bloryr.jpg (https://imagetwist.com/blo6m0bloryr/cd_s317_strap_on.jpg)
https://img202.imagetwist.com/th/45074/6bqtxl3jrehe.jpg (https://imagetwist.com/6bqtxl3jrehe/iQQsWA.jpg)

Description:
Never Released
Model:
Strap-on
Studio:
Clubdom.com
Info:
File Name : cd_s317_strap_on.mp4
File Size : 330.81 MB
Resolution : 1280x720
Duration : 00:07:03

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/a6d4f5b32dc65 (https://tezfiles.com/file/a6d4f5b32dc65)

Tiered
01-18-2022, 06:16 AM
Clubdom.com- Anna Lee Brat Chindo
https://img165.imagetwist.com/th/44828/hps8yeo2j5gs.jpg (https://imagetwist.com/hps8yeo2j5gs/s7691-3annaleebratchindo.jpg)
https://img33.imagetwist.com/th/44828/ej10baacoiwa.jpg (https://imagetwist.com/ej10baacoiwa/jObZGRA.jpg)

Description:
Goddess Anna Lee is enjoying her cigarette while she sits above her slaves courters. While this worthless slave tries to look up at her through his cage bars, Goddess Anna makes him beg her to fuck his boy pussy while she blows smoke in his face. She then informs this pathetic bitch that he must first please his Goddess and lets him out. Once her slave is unlocked and on his knees she straps a chindo to his fuck hole and instructs him that he better please her or else.
Model:
Anna Lee
Studio:
Clubdom.com
Info:
File Name : s7691-3annaleebratchindo.mp4
File Size : 329.56 MB
Resolution : 1280x720
Duration : 00:06:58

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e39c42ac3bcf3 (https://tezfiles.com/file/e39c42ac3bcf3)

Tiered
01-18-2022, 06:18 AM
Clubdom.com- Edging The Cum Slave
https://img202.imagetwist.com/th/45060/yufdtza48se2.jpg (https://imagetwist.com/yufdtza48se2/cd_s559_cadie_coxx_esmi_lee_hj_edging.jpg)
https://img119.imagetwist.com/th/45060/vyh4yg0v7zui.jpg (https://imagetwist.com/vyh4yg0v7zui/OtxWGLIK.jpg)

Description:
Mistress Esmi Lee and Mistress Candie Coxx are here to have some fun with their bound slave. The Mistresses are going to edge this poor cum slave but not before they secude him first. First they slowly tease, jerk and edge his cock. Then, they get the slave to the point of Cumming then stop making him go insane. Candie teases the cum slut with her tits making him want to spurt his load. They continue to slow jerk and edge the slaves throbbing cock finally allowing him to cum. The slave is then fed every drip of his man filth
Model:
Cadie Coxx, Esmi Lee
Studio:
Clubdom.com
Info:
File Name : cd_s559_cadie_coxx_esmi_lee_hj_edging.mp4
File Size : 297.66 MB
Resolution : 1280x720
Duration : 00:06:15

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/e94ea3a2775a3 (https://tezfiles.com/file/e94ea3a2775a3)

Tiered
01-18-2022, 06:23 AM
Clubdom.com- Earth Girls are Cruel 1
https://img119.imagetwist.com/th/45083/lhyy91s25ok9.jpg (https://imagetwist.com/lhyy91s25ok9/movie300.jpg)
https://img119.imagetwist.com/th/45083/ftzhft4yzpqk.jpg (https://imagetwist.com/ftzhft4yzpqk/IhJwuMPw.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : movie300.mp4
File Size : 24.01 MB
Resolution : 640x480
Duration : 00:02:02

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2c32f46665fa4 (https://tezfiles.com/file/2c32f46665fa4)

Tiered
01-18-2022, 06:24 AM
Clubdom.com- Fucking his tenderized ass
https://img202.imagetwist.com/th/44655/r3195boappzi.jpg (https://imagetwist.com/r3195boappzi/cd_01_13_13_straponcaningcd.jpg)
https://img119.imagetwist.com/th/44655/prygzyo0z9zh.jpg (https://imagetwist.com/prygzyo0z9zh/cd_01_13_13_straponcaningcd.mp4.jpg)

Description:
Mistresses Jean, Coral and Amadahy are going to fuck this bitch_s ass wide open with their strapons, but these sadists are not content with just pounding his ass meat they want it to hurt too. So Jean and Coral cane the bitch first, then make him get on their fucking bench.

Each of the Mistresses takes a turn fucking his ass deep and hard with their cocks while the bitch has to suck the cock of one of the other Mistresses. By the time Amadahy is plowing his ass with her dick, the bitch is begging for mercy, but none will be had.
Model:
Coral, Goddess Amadahy, Jean Bardot
Studio:
Clubdom.com
Info:
File Name : cd_01_13_13_straponcaningcd.mp4
File Size : 47.03 MB
Resolution : 640x360
Duration : 00:05:50

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/c790dda4ae294 (https://tezfiles.com/file/c790dda4ae294)

Tiered
01-18-2022, 06:25 AM
Clubdom.com- Natalia Starr Feet POV
https://img202.imagetwist.com/th/45051/tc2vtlgkfwra.jpg (https://imagetwist.com/tc2vtlgkfwra/cd_s905_natalyastarr_feetpov.jpg)
https://img119.imagetwist.com/th/45051/c5swwaq7bx2p.jpg (https://imagetwist.com/c5swwaq7bx2p/sDgoLk.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Natalia Starr
Studio:
Clubdom.com
Info:
File Name : cd_s905_natalyastarr_feetpov.mp4
File Size : 209.58 MB
Resolution : 1280x720
Duration : 00:04:24

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/6c67181349b53 (https://tezfiles.com/file/6c67181349b53)

Tiered
01-18-2022, 06:29 AM
Clubdom.com- Kiss Lady Cheyenne Hand
https://img202.imagetwist.com/th/45169/z2ts0wk4bk66.jpg (https://imagetwist.com/z2ts0wk4bk66/ATaGhmV.jpg)
https://img119.imagetwist.com/th/45169/ntqvad3x14nw.jpg (https://imagetwist.com/ntqvad3x14nw/rKTjHkFT.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie505.wmv
File Size : 11.6 MB
Resolution : 320x240
Duration : 00:03:07

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/8827ea3b5b12b (https://tezfiles.com/file/8827ea3b5b12b)

Tiered
01-18-2022, 06:32 AM
Clubdom.com- 2 Mistreses StrapOn Fuck Slave
https://img202.imagetwist.com/th/45180/j0asrcefnvp7.jpg (https://imagetwist.com/j0asrcefnvp7/cd_s239_strap_on.jpg)
https://img202.imagetwist.com/th/45180/aq1f7r9b90pq.jpg (https://imagetwist.com/aq1f7r9b90pq/YbElnGtM.jpg)

Description:
Never Released
Model:
Strap-on
Studio:
Clubdom.com
Info:
File Name : cd_s239_strap_on.mp4
File Size : 331.24 MB
Resolution : 1280x720
Duration : 00:07:02

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/cc83bf5a6d7c9 (https://tezfiles.com/file/cc83bf5a6d7c9)

Tiered
01-18-2022, 06:39 AM
Clubdom.com- Lady Cheyenne Whips a Slave_s Backside
https://img165.imagetwist.com/th/45048/5phyhr0sxxit.jpg (https://imagetwist.com/5phyhr0sxxit/FXZzaVi.jpg)
https://img119.imagetwist.com/th/45048/6pwqo3wi1k57.jpg (https://imagetwist.com/6pwqo3wi1k57/sScDnjYp.jpg)

Description:
Lady Cheyenne whips a slave_s backside..
Model:
Teens girls, beautiful girl, milf
Studio:
Clubdom.com
Info:
File Name : Movie298.wmv
File Size : 11.65 MB
Resolution : 320x240
Duration : 00:03:08

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/870853013f8f4 (https://tezfiles.com/file/870853013f8f4)

Tiered
01-18-2022, 06:54 AM
Clubdom.com- Milking Day For Slave 032
https://img119.imagetwist.com/th/45060/rq7cwwev1l6j.jpg (https://imagetwist.com/rq7cwwev1l6j/cd_s1121_4-4_mistressdahlia_dominahelena_cbt.jpg)
https://img202.imagetwist.com/th/45060/rf8jozict245.jpg (https://imagetwist.com/rf8jozict245/FJrdmcee.jpg)

Description:
Disappointed with the filth production from their slave, Mistress Dahlia and Domina Helena want to pulverize his slut sacks since they are so worthless. They grab and twist his slut sacks and beat them with their crops. Maybe their pathetic slave will remember this and try harder to produce next time the Goddesses want to milk him.
Model:
Dahlia Rain, Domina Helena
Studio:
Clubdom.com
Info:
File Name : cd_s1121_4-4_mistressdahlia_dominahelena_cbt.mp4
File Size : 288.19 MB
Resolution : 1280x720
Duration : 00:06:10

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/9407e69b1bfbd (https://tezfiles.com/file/9407e69b1bfbd)

Tiered
01-18-2022, 06:56 AM
Clubdom.com- Alexis Grace And Macy_s Small Penis Instruction
https://img33.imagetwist.com/th/44668/qzrk6fsl44dt.jpg (https://imagetwist.com/qzrk6fsl44dt/alexisgracemacyssmallpenisinstruction.jpg)
https://img119.imagetwist.com/th/44668/mz3815fojcsv.jpg (https://imagetwist.com/mz3815fojcsv/alexisgracemacyssmallpenisinstruction.mp4.jpg)

Description:
Mistress Macy and Mistress Alexis have you pull out that tiny cock of your. They cant believe how tiny that little dick clit is. Mistress Alexis is smoking a cigarette and cant help but to see that her cigaret is actually bigger then your pathtic cock. The Mistress know what a premature ejaculater you are so they make you stop and make you smack your balls. The Mistress then tell you to shove your fingers in your own asshole. After you have been thoroughly humiliated the Mistresses let you jerk that tiny cock of your. The Mistresses only allow three strokes at a time. Finally the Mistress feel you have been humiliated enough and its time to cum. You show your Mistresses how really pathetic you are by only producing a few little driblets. The Mistress are not impressed with that worthless load tell you to go and put it right back in you. The Mistresses make you clean your hands spotless.
Model:
Alexis Grace, Macy Cartel
Studio:
Clubdom.com
Info:
File Name : alexisgracemacyssmallpenisinstruction.mp4
File Size : 123.92 MB
Resolution : 640x360
Duration : 00:05:34

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ce248298f34d0 (https://tezfiles.com/file/ce248298f34d0)

Tiered
01-18-2022, 07:22 AM
Clubdom.com- Mistress Caning Servant
https://img69.imagetwist.com/th/44743/92e7ssxallrr.jpg (https://imagetwist.com/92e7ssxallrr/s460_caning.jpg)
https://img33.imagetwist.com/th/44743/pdp92eta8vdf.jpg (https://imagetwist.com/pdp92eta8vdf/s460_caning.mp4.jpg)

Description:
Kendra James and Zoey Portland have bound their slave in a precarious position. His head is down and his bare ass is in the air. The trembling slave will we used for the ladies to enjoy their sadistic desires. The ladies burn the slut_s ass up with their canes. They enjoy bringing the slut to tears as they produce red and purples on the slut_s. Zoey gets so turn on by the bitch_s suffering that she hops on top of him and rubs her wet pussy on his back as Kendra finishes the bitch off with the most severe strokes yet
Model:
Kendra James, Zoey Portland
Studio:
Clubdom.com
Info:
File Name : s460_caning.mp4
File Size : 312.13 MB
Resolution : 1280x720
Duration : 00:06:38

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2460999c79878 (https://tezfiles.com/file/2460999c79878)

Tiered
01-18-2022, 07:23 AM
Clubdom.com- Miss Roper and the Disobedient slave (Full Movie)
https://img202.imagetwist.com/th/45184/pdgpq7024otx.jpg (https://imagetwist.com/pdgpq7024otx/cd_s1373_minimovie_raquelroper.jpg)
https://img119.imagetwist.com/th/45184/qo1joudi820j.jpg (https://imagetwist.com/qo1joudi820j/heQgkXl.jpg)

Description:
Contains four movies: Slapped by Miss Roper For Disobedience, Paddled by Miss Roper For Disobedience, Miss Ropers Stretches his Whore Hole, Miss Ropers slave Gets His Reward.

Miss Ropers slave has been bad today. She has told her slut several times to always wear a hood in her presence. When she comes in the dungeon to inspect his work, she finds him with an uncovered face. That is totally unacceptable to Miss Roper and her slut must be punished before he gets his reward of cock. First, Miss Roper gives her slut a hard face slapping and spitting session. That was going to be his punishment but he took too long to find his hood. Miss Roper decides to give her slave a harsh and severe paddling. Now that her slut has been properly punished, Miss Roper can give him his reward. Before she can fuck her slave though, she must stretch out his throat and ass. She uses a giant hand shaped dildo to get her slut ready for his fucking. Now is the time for Miss Roper to make her slaves slutty dreams come true. She first makes her slut get her big red strap on wet by gagging his throat with her cock. Then its time to fuck her slut silly. Her slave cries and moans as Miss Roper mercilessly pounds his ass in several positions. One thing is for sure his ass belongs to Miss Roper
Model:
Miss Roper
Studio:
Clubdom.com
Info:
File Name : cd_s1373_minimovie_raquelroper.mp4
File Size : 1178.87 MB
Resolution : 1280x720
Duration : 00:24:44

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/8d7ee1de1021a (https://tezfiles.com/file/8d7ee1de1021a)

Tiered
01-18-2022, 07:23 AM
Clubdom.com- Beaten and Busted
https://img202.imagetwist.com/th/45051/826k539mci8h.jpg (https://imagetwist.com/826k539mci8h/cd_s1039_qandisa_amadahy_ballbust.jpg)
https://img119.imagetwist.com/th/45051/4k6z2wwypwnu.jpg (https://imagetwist.com/4k6z2wwypwnu/oaoCvRP.jpg)

Description:
Queen Qandisa and Goddess Amadahy drag their slave into the barn. It_s time for some ball games They squeal, excitedly. Amadahy delivers some hard belly punches to the slave first to render him breathless in order for him to become weaker. The women demand he hold his hands above his head while they deliver the hardest kicks in years. He falls to the floor over and over again but still they demand him to stand and take more pain. Amadahy squeezes the slave_s neck between her legs and tries to make him reach to kiss her feet but he just can_t as she chokes him. Eventually the women grab his balls and are digging their nails in, discussing how much he suffered for them today.
Model:
Goddess Amadahy, Queen Qandisa
Studio:
Clubdom.com
Info:
File Name : cd_s1039_qandisa_amadahy_ballbust.mp4
File Size : 299.79 MB
Resolution : 1280x720
Duration : 00:06:22

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ca147453041f8 (https://tezfiles.com/file/ca147453041f8)

Tiered
01-18-2022, 07:24 AM
Clubdom.com- The Slaves Must Be Punished
https://img33.imagetwist.com/th/44667/7dg7aa8c6wyt.jpg (https://imagetwist.com/7dg7aa8c6wyt/06_10_13_femdompov.jpg)
https://img202.imagetwist.com/th/44667/q9hi69ahqivy.jpg (https://imagetwist.com/q9hi69ahqivy/06_10_13_femdompov.mp4.jpg)

Description:
As Mistresses Kendra and Mena relax and smoke their cigarettes, they discuss how pathetic and needy the stable slaves are, constantly begging for any attention. While the Mistresses enjoy their smoke break, they use one of the stable slaves as human furniture for their boots.

Kendra notices that her boots are not as shiny as they should be once she and Mena determine which slave was responsible for their boots, they agree he must be severely punished. As soon as they finish enjoying their cigarettes, stable slave 67 is in deep trouble.
Model:
Kendra James
Studio:
Clubdom.com
Info:
File Name : 06_10_13_femdompov.mp4
File Size : 116.19 MB
Resolution : 640x360
Duration : 00:05:13

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ae7ee73603503 (https://tezfiles.com/file/ae7ee73603503)

Tiered
01-18-2022, 07:30 AM
Clubdom.com- Pain For Her Cane
https://img202.imagetwist.com/th/44721/aynpytrmoxk2.jpg (https://imagetwist.com/aynpytrmoxk2/painforhercane.jpg)
https://img202.imagetwist.com/th/44721/q9qyohx2kt4n.jpg (https://imagetwist.com/q9qyohx2kt4n/painforhercane.mp4.jpg)

Description:
Goddess_s Kendra James and Jessica Rayne are having a sadistic moment. They drag a stable bitch out, put him on his knees and begin tormenting him with their bamboo canes. The ladies are simply evil as they describe the pain they will begin to inflict on this trembling slut. Once the male bitch is bent over the caning horse, the Goddess_s go wild, with one brute force stroke after another. The more the slut cries out, the more the ladies welt his helpless ass. Kendra and Jessica are simply glowing as they devour this terrified male bitch.
Model:
Jessica Rayne, Kendra James
Studio:
Clubdom.com
Info:
File Name : painforhercane.mp4
File Size : 259.71 MB
Resolution : 640x360
Duration : 00:08:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/43a654ff7894c (https://tezfiles.com/file/43a654ff7894c)

Tiered
01-18-2022, 07:30 AM
Clubdom.com- Nikki Brooks High Heel Humiliation
https://img119.imagetwist.com/th/45053/c6cz24cdg13s.jpg (https://imagetwist.com/c6cz24cdg13s/cd_s1072_nikkibrooks_highheel.jpg)
https://img119.imagetwist.com/th/45053/dlhatdrgd9ve.jpg (https://imagetwist.com/dlhatdrgd9ve/JkfeqIJ.jpg)

Description:
Club Dom features famous Mistresses from around the world engaging in slave training, corporal punishment, ball-busting, CBT, strap-on, and more.
Model:
Nikki Brooks
Studio:
Clubdom.com
Info:
File Name : cd_s1072_nikkibrooks_highheel.mp4
File Size : 358.72 MB
Resolution : 1280x720
Duration : 00:07:36

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/2843d05fec293 (https://tezfiles.com/file/2843d05fec293)

Tiered
01-18-2022, 07:32 AM
Clubdom.com- Tiny Dicks Untriumphant Return Part 5
https://img119.imagetwist.com/th/44669/rr1j0zah3nuc.jpg (https://imagetwist.com/rr1j0zah3nuc/tinydicksuntriumphantreturnpt5.jpg)
https://img119.imagetwist.com/th/44669/mq2o9xtahqus.jpg (https://imagetwist.com/mq2o9xtahqus/tinydicksuntriumphantreturnpt5.mp4.jpg)

Description:
The Goddess_s made the last loser cry and are gloating about it. All of a sudden the last losers dad comes in. Its El Torro and hes livid El Torro yells at the Goddess but they quickly shut him up it with a barrage of kicks to the nuts. The Goddess_s let him no this is there gym now and they will do as they please. The Goddess take turns busting El Torro_s balls till he is he completely submits to the Goddess_s.
Model:
Goddess Amadahy
Studio:
Clubdom.com
Info:
File Name : tinydicksuntriumphantreturnpt5.mp4
File Size : 110.13 MB
Resolution : 640x360
Duration : 00:04:59

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/ef6d2f95f4e49 (https://tezfiles.com/file/ef6d2f95f4e49)

Tiered
01-18-2022, 07:34 AM
Clubdom.com- Brutal Buttfucking
https://img33.imagetwist.com/th/44667/0wde7bmoelax.jpg (https://imagetwist.com/0wde7bmoelax/brutalbuttfucking.jpg)
https://img119.imagetwist.com/th/44667/a9bdanwqy04q.jpg (https://imagetwist.com/a9bdanwqy04q/brutalbuttfucking.mp4.jpg)

Description:
Goddess Amadahy and Mistress Kendra James have presented there cocks to there slaves. The slaves know its time for them to do some hardcore dick sucking. The mistresses forces there big black strap-on cocks deep down there slaves throat. They make the slaves gag on there thick black cocks and slobber all over them. The mistresses makes sure there cocks are nice and slobbery for what they do next. The mistress bend over there _ and shove there big black cocks in there cock hungry slut holes. The mistress don_t give the _ sensual thrusts they give the _ a ruthless pounding. The mistresses verbally let them know what little disgusting whores they are as they continue to pound the slaves asses. Kendra and Amadahy show no mercy to their _ as they shove there long thick black cocks deep in there slut holes.
Model:
Goddess Amadahy, Kendra James
Studio:
Clubdom.com
Info:
File Name : brutalbuttfucking.mp4
File Size : 90.78 MB
Resolution : 640x360
Duration : 00:09:36

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4ba81ee8d53ef (https://tezfiles.com/file/4ba81ee8d53ef)

Tiered
01-18-2022, 07:34 AM
Clubdom.com- Goddess Valora Punishes Her Sissy slave
https://img119.imagetwist.com/th/45183/15g4q25e9y24.jpg (https://imagetwist.com/15g4q25e9y24/cd_s1358_valora_paddling.jpg)
https://img202.imagetwist.com/th/45183/t1h28bbsvthp.jpg (https://imagetwist.com/t1h28bbsvthp/ZcoSYs.jpg)

Description:
Goddess Valora is standing in the dungeon wearing a huge black strap on cock. She has her sissy slave on his knees waiting obediently in front of her. He is wearing slutty fishnet stockings and a lacy lingerie top. There is only one thing missing, red whore lipstick. Goddess Valora tells her slut to pout his, dick sucking, lips so she can make him look like a proper slut. Goddess Valora asks her whore if he is ready to suck her huge cock. The slut answers, yes, Mistress Valora Wrong Answer Goddess Valora slaps the shit out of her pathetic _ face repeatedly and spits on him. He will never make that mistake again. However, Goddess Valora insists on punishing her disrespectful sissy slave further. She orders the slut to get on the spanking bench and to present his ass. This is usually where the sissy would have his slutty ass fucked. Now its for punishment. Goddess uses a leather strap to thoroughly paddle his ass. When his ass is nice and warmed up, Goddess Valora switches to a larger wooden paddle. She has no mercy on bad sissy slaves You can see the joy on Goddess Valoras face as her slave cries out in pain. If he can take all of his punishment, Goddess Valora might let him suck her big black cock.
Model:
Goddess Valora
Studio:
Clubdom.com
Info:
File Name : cd_s1358_valora_paddling.mp4
File Size : 246.91 MB
Resolution : 1280x720
Duration : 00:05:14

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/1acf0f7814854 (https://tezfiles.com/file/1acf0f7814854)

Tiered
01-18-2022, 07:42 AM
Clubdom.com- And She Will Own your Balls
https://img202.imagetwist.com/th/44736/yw94xiwypzkn.jpg (https://imagetwist.com/yw94xiwypzkn/2_6_14bootlickraven.jpg)
https://img202.imagetwist.com/th/44737/2fu0fc6rvbd9.jpg (https://imagetwist.com/2fu0fc6rvbd9/2_6_14bootlickraven.mp4.jpg)

Description:
Raven has been very unhappy in her marriage. Fortunately, for her she has seen a marriage counselor. Raven is now equipped with advice on how to control her man. She begins by owning his cock and balls. It is foreign to her but she puts her husbands balls in a device that keeps him still and begins to crop his balls. Raven puts a gag in her husband_s mouth when he begins to scream and goes back at his cock with her crop. She really enjoys learning how to own her husband_s slutty cock. Raven holds nothing back as her shocked husband is in despair.
Model:
Raven Bay
Studio:
Clubdom.com
Info:
File Name : 2_6_14bootlickraven.mp4
File Size : 582.66 MB
Resolution : 1280x720
Duration : 00:15:57

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/5c1f3e628d3d0 (https://tezfiles.com/file/5c1f3e628d3d0)

Tiered
01-18-2022, 07:42 AM
Clubdom.com- A Painful Predicament
https://img119.imagetwist.com/th/45075/ez8z2mvco9yh.jpg (https://imagetwist.com/ez8z2mvco9yh/cd_s1242_michellelacy_nippletorture.jpg)
https://img202.imagetwist.com/th/45075/wn3en8ilodps.jpg (https://imagetwist.com/wn3en8ilodps/jdOrnhz.jpg)

Description:
No one knows how to put slaves in painful predicaments better than Mistress Michelle Lacy. How will she hurt the slave more, through his nipples, or through his balls which is holding the 10 pound spreader bar? Mistress Michelle puts the painful tower clamps on his nipples and she tightens them more and more until his nipples are totally stretched out and she torments his already weighed down balls. The slave has a choice, he will get a caning, or endure more of what she is currently doing. What will he decide?&nbsp
Model:
Michelle Lacy
Studio:
Clubdom.com
Info:
File Name : cd_s1242_michellelacy_nippletorture.mp4
File Size : 213.17 MB
Resolution : 1280x720
Duration : 00:04:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/4fa00ee0d9722 (https://tezfiles.com/file/4fa00ee0d9722)

Tiered
01-18-2022, 07:45 AM
Clubdom.com- Repair Men at ClubDom (Bg make your Mistress Cum) Pt 2‏
https://img119.imagetwist.com/th/45073/p3c8pq6zb5he.jpg (https://imagetwist.com/p3c8pq6zb5he/cd_s569_2-5_jean_bardot_kylie_rogue.jpg)
https://img119.imagetwist.com/th/45073/ej176rowcqda.jpg (https://imagetwist.com/ej176rowcqda/aStcDtjY.jpg)

Description:
Goddess Jean Bardot and Mistress Kylie Rogue just finished draining loud mouth Lew of his pathetic man filth. Now they turn their attention to repair boy Alex. Jean pulls his bitch ass out of the cage and asked him if he thinks he can fuck his way out of this one. His buddy, loud mouth Lew has put him in this predicament and Jeans giving him a chance to get out of it. He has exactly 3 minutes to make Mistess Kylie orgasm. Jean asks you think you can do it bitch? Yes Goddess. Alex is terrified and shaking. Jean and Kylie laugh as Jean shoves his face right in Kylies wet pink pussy telling him to breathe in his goddess. She makes him lick it and lube it up and then the countdown begins. Alex is fucking her vigorously with everything he_s got trying to get out of the situation. He pounds her as hard as he possibly can. Mistress Kylie cums but so does Alex, right in his condom. The ladies laugh at his humiliation then dunk the condom in and out of his mouth like a little teabag. Proceeding to dump his disgusting man filth right in his filthy fuck hole. Eat it up bitch boy your day has just begun
Model:
Jean Bardot, Kylie Rogue
Studio:
Clubdom.com
Info:
File Name : cd_s569_2-5_jean_bardot_kylie_rogue.mp4
File Size : 345.28 MB
Resolution : 1280x720
Duration : 00:07:20

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/580547cc50148 (https://tezfiles.com/file/580547cc50148)

Tiered
01-18-2022, 07:46 AM
Clubdom.com- Charlyse Angel Kendra
https://img202.imagetwist.com/th/45074/mmjb49qn4rgs.jpg (https://imagetwist.com/mmjb49qn4rgs/cd_s428_full_charlyse_angel_kendra_james.jpg)
https://img119.imagetwist.com/th/45075/e7kd4xuugtsz.jpg (https://imagetwist.com/e7kd4xuugtsz/XQOResv.jpg)

Description:
Never Released
Model:
Charlyse Angel, Kendra James
Studio:
Clubdom.com
Info:
File Name : cd_s428_full_charlyse_angel_kendra_james.mp4
File Size : 1255.74 MB
Resolution : 1280x720
Duration : 00:26:29

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/291782332f8c8 (https://tezfiles.com/file/291782332f8c8)

Tiered
01-18-2022, 08:02 AM
Clubdom.com- Esmi_s Cum On Your Face
https://img165.imagetwist.com/th/44662/ufpdg8qwbfjb.jpg (https://imagetwist.com/ufpdg8qwbfjb/cd_03_16_13_chindildo.jpg)
https://img165.imagetwist.com/th/44662/0vwhwktluaak.jpg (https://imagetwist.com/0vwhwktluaak/cd_03_16_13_chindildo.mp4.jpg)

Description:
Mistress Venus tells her slave that he is going to provide pleasure for Mistress Esmi, then puts him to work pleasuring her pussy with the chin dildo strapped to his face. Gut Venus wants to make sure the bitch does not enjoy it, beating his bound balls with her riding crop as he thrusts the dildo in again and again. When Esmi cums she makes sure to wipe it all over the bitch_s face, laughing at how pathetic he is.
Model:
Esmi Lee, Venus Divine
Studio:
Clubdom.com
Info:
File Name : cd_03_16_13_chindildo.mp4
File Size : 308.86 MB
Resolution : 1280x720
Duration : 00:06:30

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/f891eee0087cf (https://tezfiles.com/file/f891eee0087cf)

Tiered
01-18-2022, 08:08 AM
Clubdom.com- Dava Foxx Ball Tugging Two Guys
https://img165.imagetwist.com/th/44829/ndspkd9jtkr0.jpg (https://imagetwist.com/ndspkd9jtkr0/s771davafoxxballtug.jpg)
https://img119.imagetwist.com/th/44829/6foxfjhx7eq3.jpg (https://imagetwist.com/6foxfjhx7eq3/frEzhbE.jpg)

Description:
Goddess Dava Foxx knows how to have a good time, She has two of her pathetic slaves slut sacks tied off and attached to her suspension device and is going to be stretching their slut sacks today. First, she starts off by measuring both of the slaves nuts then she starts cranking on the hoist and laughing as the slaves scream and cry as she stretches their nut sacks, Then she measures again, and decides that they have a long way to go and flips the bitches over to continue with more torture and ball stretching, Now firmly gripping their slut sacks, she feels that she can do better but first starts to drive her long fingernails into their scrotums as they cry and beg for mercy, She just laughs and tells them that this is what makes her pussy wet, she then decides to just walk off and let them continue stretching for the rest of the day.
Model:
Dava Foxx
Studio:
Clubdom.com
Info:
File Name : s771davafoxxballtug.mp4
File Size : 341.03 MB
Resolution : 1280x720
Duration : 00:07:15

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/21edfd5948464 (https://tezfiles.com/file/21edfd5948464)

Tiered
01-18-2022, 08:20 AM
Clubdom.com- Tiny Dick_s Beatdown Part 3
https://img119.imagetwist.com/th/44719/mj2p97nihr17.jpg (https://imagetwist.com/mj2p97nihr17/tinydickebeatdown3.jpg)
https://img202.imagetwist.com/th/44719/k6fngan8iruk.jpg (https://imagetwist.com/k6fngan8iruk/tinydickebeatdown3.mp4.jpg)

Description:
Alexis and Kendra are going to show Tiny Dick and El Blanco whose boss with there big black strap on cocks. The goddess use lube but its the losers own semen that is used for lubrication. The Goddess_s then bend over the bitches and forcefully stick there big black cocks in the losers ass_s. Tiny Dick has once again been defeated and painfully remind minded of how much of small dick loser he is with every stroke. The Goddess_s laugh at how they completely defeated the losers as they fuck there man pussies hard and fast. The Goddess will need there cocks cleaned as well as the mats they work out on. The Goddess_s will uses the losers tongues to do the cleaning.
Model:
Alexis Grace, Kendra James
Studio:
Clubdom.com
Info:
File Name : tinydickebeatdown3.mp4
File Size : 237.06 MB
Resolution : 640x360
Duration : 00:07:41

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/85679ecef1475 (https://tezfiles.com/file/85679ecef1475)

Tiered
01-18-2022, 08:20 AM
Clubdom.com- Buttfucking Torment By Three Cocks
https://img119.imagetwist.com/th/44669/fi1fyp8odtls.jpg (https://imagetwist.com/fi1fyp8odtls/buttfuckingtormentbythreecocks.jpg)
https://img165.imagetwist.com/th/44669/farwq2nq3h2y.jpg (https://imagetwist.com/farwq2nq3h2y/buttfuckingtormentbythreecocks.mp4.jpg)

Description:
The slaves are crying in there cages as the Mistress_s smoke and think of the next way they are going to torment the losers. The Mistress_s decide they are going to have a fuck fest. The Mistress_s put on there Strap-Ons and are ready to fuck some man pussies. The slave cry louder as they await the torment that is soon to cum. The Mistress_s forcefully take the slaves out there kennels and make the slaves deep throat there cocks. The Mistress_s make the slave drool on there dicks as they shove the cocks deep down there throats. The Mistress_s force there bitches to have a blow bang before they bang the bitches. The Mistresses bend over the slaves and roughly shove there giant cocks in there man pussies. The Mistress_s fuck there slaves hard and rough and make sure its nice and painful. The _ take there Mistress_s cocks like good little whores. After Mistress_s destroy the slaves assholes the Mistress_s sit back and have a smoke again. The Mistress_s relax laugh at the agonizing pain there worthless slaves are in.
Model:
Esmi Lee
Studio:
Clubdom.com
Info:
File Name : buttfuckingtormentbythreecocks.mp4
File Size : 153.12 MB
Resolution : 640x360
Duration : 00:06:50

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/59fdba01ab052 (https://tezfiles.com/file/59fdba01ab052)

Tiered
01-18-2022, 08:28 AM
Clubdom.com- Boot Faggot Jerkoff
https://img119.imagetwist.com/th/44656/c1xaoucg7kdz.jpg (https://imagetwist.com/c1xaoucg7kdz/cd_01_20_13_bootworship.jpg)
https://img33.imagetwist.com/th/44657/o48cjvd6wahj.jpg (https://imagetwist.com/o48cjvd6wahj/cd_01_20_13_bootworship.mp4.jpg)

Description:
Mistresses Simone and Esmi have their bitch worship their boots, laughing at what a pathetic boot faggot he is. Today is his lucky day because the Mistresses want their boots thoroughly cleaned, and this bitch is going to lick every inch - especially the boot bottoms

When the Mistresses notice how hard his cock gets licking their boots, they jerk it off with their boots, then order him to hump their boots like a . They then allow their slave to jerk off and cum on their boots, laughing at how horny and helpless their boots make him. Of course the bitch then has to lick their boots until he has eaten all of his cum.
Model:
Esmi Lee, Simone Kross
Studio:
Clubdom.com
Info:
File Name : cd_01_20_13_bootworship.mp4
File Size : 52.25 MB
Resolution : 640x360
Duration : 00:06:31

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/cde572484c20c (https://tezfiles.com/file/cde572484c20c)

Tiered
01-18-2022, 08:31 AM
Clubdom.com- Alexia Jordan Whips The Slave
https://img119.imagetwist.com/th/45055/w5vlxz2i7fij.jpg (https://imagetwist.com/w5vlxz2i7fij/cd_s537_alexia_jordan_whipping.jpg)
https://img119.imagetwist.com/th/45055/tbbxlsastkba.jpg (https://imagetwist.com/tbbxlsastkba/HLZFRz.jpg)

Description:
Watch as Alexia Jordan lets her caged slave out and ties him up because he was being bad, then whips him till he begs the safe word..
Model:
Alexia Jordan
Studio:
Clubdom.com
Info:
File Name : cd_s537_alexia_jordan_whipping.mp4
File Size : 244.25 MB
Resolution : 1280x720
Duration : 00:05:16

Download VIDEO:
Tezfiles Video: https://tezfiles.com/file/d1f43235207a3 (https://tezfiles.com/file/d1f43235207a3)